BLASTX nr result
ID: Cephaelis21_contig00049921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00049921 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 59 3e-07 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 55 4e-06 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 59.3 bits (142), Expect = 3e-07 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 3/67 (4%) Frame = -2 Query: 222 TPLLIQALLNNSNNPKLAWQIFKRTSLSVP---NLFFQTLPTITRILLASNMLFEINFLH 52 T L +ALLNN++NPKLAW +FKR LS+P N Q++P I+RIL+ S M E++ LH Sbjct: 4 TTKLTKALLNNAHNPKLAWHLFKRI-LSLPISSNHRSQSIPIISRILIRSKMFNELDDLH 62 Query: 51 HFLLCQP 31 LL P Sbjct: 63 QLLLNSP 69 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 4/68 (5%) Frame = -2 Query: 213 LIQALLNNSNNPKLAWQIFKR----TSLSVPNLFFQTLPTITRILLASNMLFEINFLHHF 46 L++ALL N+NNP+LAW+IFKR S + PTI RIL+ + M EI LH+ Sbjct: 5 LVKALLKNTNNPRLAWRIFKRIFSSPSEESHGISLDATPTIARILVRAKMHEEIQELHNL 64 Query: 45 LLCQPLQK 22 +L +QK Sbjct: 65 ILSSSIQK 72