BLASTX nr result
ID: Cephaelis21_contig00048336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048336 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520384.1| PREDICTED: uncharacterized protein LOC100795... 94 2e-17 emb|CAN70024.1| hypothetical protein VITISV_030172 [Vitis vinifera] 88 6e-16 gb|AFN88207.1| integrase core domain containing protein [Phaseol... 87 2e-15 emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera] 86 2e-15 emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera] 86 3e-15 >ref|XP_003520384.1| PREDICTED: uncharacterized protein LOC100795634 [Glycine max] Length = 1815 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = -1 Query: 352 VFGCVCFAHQLTPGMDKFFPRSYKCIFLWYARHQKGYHCYSPTLRRYFICADVTFFE 182 VFGC CF H L+PG+DK RS KC+FL Y+R QKGY CYSPT+RRY++ ADVTFFE Sbjct: 809 VFGCTCFVHDLSPGLDKLSARSVKCVFLGYSRLQKGYKCYSPTMRRYYMSADVTFFE 865 >emb|CAN70024.1| hypothetical protein VITISV_030172 [Vitis vinifera] Length = 1091 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = -1 Query: 352 VFGCVCFAHQLTPGMDKFFPRSYKCIFLWYARHQKGYHCYSPTLRRYFICADVTFFE 182 VFGC CF H LTPG DK ++ KCIFL Y+R QKGY CYSP RYF+ ADVTFFE Sbjct: 520 VFGCTCFVHTLTPGQDKLSAKATKCIFLGYSRLQKGYRCYSPDTHRYFLSADVTFFE 576 >gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris] Length = 1387 Score = 86.7 bits (213), Expect = 2e-15 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = -1 Query: 352 VFGCVCFAHQLTPGMDKFFPRSYKCIFLWYARHQKGYHCYSPTLRRYFICADVTFFET 179 VFG CF H +PG+DK PRS+KC+FL + R QKGY C+SP+L RYFI ADVTF E+ Sbjct: 705 VFGSTCFVHNFSPGLDKLSPRSHKCVFLGFTRSQKGYKCFSPSLNRYFISADVTFSES 762 >emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera] Length = 1170 Score = 86.3 bits (212), Expect = 2e-15 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -1 Query: 352 VFGCVCFAHQLTPGMDKFFPRSYKCIFLWYARHQKGYHCYSPTLRRYFICADVTFFE 182 VFGC CF H LTPG DK ++ KCIFL Y+R QKGY CYSP RYF+ DVTFFE Sbjct: 509 VFGCTCFVHTLTPGQDKLSAKATKCIFLGYSRLQKGYRCYSPDTHRYFLSIDVTFFE 565 >emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera] Length = 1535 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -1 Query: 352 VFGCVCFAHQLTPGMDKFFPRSYKCIFLWYARHQKGYHCYSPTLRRYFICADVTFFE 182 VF C CF H LTPG DK ++ KCIFL Y+R QKGY CYSP RYF+ ADVTFFE Sbjct: 1092 VFSCTCFVHTLTPGQDKLSAKATKCIFLGYSRLQKGYRCYSPDTHRYFLSADVTFFE 1148