BLASTX nr result
ID: Cephaelis21_contig00047907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047907 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551472.1| PREDICTED: uncharacterized protein LOC100795... 101 7e-20 ref|XP_002891861.1| zinc ion binding protein [Arabidopsis lyrata... 95 5e-18 gb|AAF79318.1|AC002304_11 F14J16.17 [Arabidopsis thaliana] 94 1e-17 ref|NP_564704.2| zinc ion binding protein [Arabidopsis thaliana]... 94 1e-17 ref|XP_002522770.1| conserved hypothetical protein [Ricinus comm... 93 2e-17 >ref|XP_003551472.1| PREDICTED: uncharacterized protein LOC100795976 [Glycine max] Length = 409 Score = 101 bits (251), Expect = 7e-20 Identities = 49/59 (83%), Positives = 51/59 (86%) Frame = +1 Query: 196 MNSGDLNKVWEIRALKRKPKEEEARKILEKIAAQVQPIMCKHKWRVKLLSEMCPSNGAL 372 MN GDLNKVWEIRALKRKP EEA K+LEKIA QVQPIM KHKWR+KLLSEMCPSN L Sbjct: 1 MNVGDLNKVWEIRALKRKPAAEEATKMLEKIAKQVQPIMRKHKWRIKLLSEMCPSNPRL 59 >ref|XP_002891861.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297337703|gb|EFH68120.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 401 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/59 (74%), Positives = 50/59 (84%) Frame = +1 Query: 196 MNSGDLNKVWEIRALKRKPKEEEARKILEKIAAQVQPIMCKHKWRVKLLSEMCPSNGAL 372 MN GDLNKVWEI+ALK+KP+ +EARKILEK+A QVQPIM + KWRVKLLSE CP N L Sbjct: 1 MNLGDLNKVWEIKALKKKPRADEARKILEKVANQVQPIMTRRKWRVKLLSEFCPKNPML 59 >gb|AAF79318.1|AC002304_11 F14J16.17 [Arabidopsis thaliana] Length = 450 Score = 94.0 bits (232), Expect = 1e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +1 Query: 199 NSGDLNKVWEIRALKRKPKEEEARKILEKIAAQVQPIMCKHKWRVKLLSEMCPSNGAL 372 N DLNKVWEI+ALKRKP+E+EARKILEK+A QVQPIM + KWRVKLLSE CP+N L Sbjct: 59 NLEDLNKVWEIKALKRKPREDEARKILEKVANQVQPIMTRRKWRVKLLSEFCPTNPRL 116 >ref|NP_564704.2| zinc ion binding protein [Arabidopsis thaliana] gi|110738098|dbj|BAF00982.1| hypothetical protein [Arabidopsis thaliana] gi|119935912|gb|ABM06032.1| At1g55915 [Arabidopsis thaliana] gi|332195198|gb|AEE33319.1| zinc ion binding protein [Arabidopsis thaliana] Length = 404 Score = 94.0 bits (232), Expect = 1e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +1 Query: 199 NSGDLNKVWEIRALKRKPKEEEARKILEKIAAQVQPIMCKHKWRVKLLSEMCPSNGAL 372 N DLNKVWEI+ALKRKP+E+EARKILEK+A QVQPIM + KWRVKLLSE CP+N L Sbjct: 5 NLEDLNKVWEIKALKRKPREDEARKILEKVANQVQPIMTRRKWRVKLLSEFCPTNPRL 62 >ref|XP_002522770.1| conserved hypothetical protein [Ricinus communis] gi|223538008|gb|EEF39621.1| conserved hypothetical protein [Ricinus communis] Length = 404 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = +1 Query: 196 MNSGDLNKVWEIRALKRKPKEEEARKILEKIAAQVQPIMCKHKWRVKLLSEMCPSNGAL 372 MN GDLNKVWEI+ALK KP EEEA+++LEKIA QVQPIM KHKWRVK+LSE CP N AL Sbjct: 1 MNVGDLNKVWEIKALK-KPGEEEAKRMLEKIAKQVQPIMRKHKWRVKVLSEFCPKNPAL 58