BLASTX nr result
ID: Cephaelis21_contig00047901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047901 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273611.1| PREDICTED: DUF21 domain-containing protein A... 99 3e-19 ref|XP_002513643.1| conserved hypothetical protein [Ricinus comm... 87 2e-15 ref|XP_002513642.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_002327610.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|XP_004140829.1| PREDICTED: DUF21 domain-containing protein A... 66 3e-09 >ref|XP_002273611.1| PREDICTED: DUF21 domain-containing protein At5g52790 [Vitis vinifera] gi|302143780|emb|CBI22641.3| unnamed protein product [Vitis vinifera] Length = 540 Score = 99.4 bits (246), Expect = 3e-19 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 2/125 (1%) Frame = -2 Query: 408 EDVMEELLQEEILDETD--LHILNKIRLNSLPWTRXXXXXXXXXXXSQIQWRTPAASTIS 235 EDVMEELLQEEILDETD + + NKI++N LP R S + WR+P AS +S Sbjct: 415 EDVMEELLQEEILDETDEYIDVHNKIKINMLPSRRSSSRSPAVALASHLHWRSPVASPLS 474 Query: 234 SHFNTPILRSPISPYVPSPLIRPTLYASPGKSNLGSPSGSWYTVXXXXXXXXXXXXSYER 55 S +TP+L SP+SPYV IRPTL ASPG S SP+G + SYE+ Sbjct: 475 SCGHTPVLDSPVSPYVYPSFIRPTLSASPGISMPNSPAGLAGPIRSSPSPHRVSRKSYEK 534 Query: 54 LRHAG 40 +R G Sbjct: 535 IRQPG 539 >ref|XP_002513643.1| conserved hypothetical protein [Ricinus communis] gi|223547551|gb|EEF49046.1| conserved hypothetical protein [Ricinus communis] Length = 510 Score = 86.7 bits (213), Expect = 2e-15 Identities = 57/110 (51%), Positives = 64/110 (58%), Gaps = 12/110 (10%) Frame = -2 Query: 408 EDVMEELLQEEILDETDLHIL--NKIRLNSLPWTRXXXXXXXXXXXS--QIQWRTPAAST 241 EDVMEELLQEEILDETD +I I +N LP R + QIQWRTP AS Sbjct: 381 EDVMEELLQEEILDETDEYIEAHTTITINMLPSRRSPLIKSPLAAAAASQIQWRTPLASP 440 Query: 240 ISSHFN--------TPILRSPISPYVPSPLIRPTLYASPGKSNLGSPSGS 115 +SS+ TP+L SPI YV SPL RPTL ASP KS SP G+ Sbjct: 441 VSSYHQSPLSSCNLTPLLHSPIPAYVRSPLARPTLSASPEKSVPNSPPGT 490 >ref|XP_002513642.1| conserved hypothetical protein [Ricinus communis] gi|223547550|gb|EEF49045.1| conserved hypothetical protein [Ricinus communis] Length = 517 Score = 71.6 bits (174), Expect = 6e-11 Identities = 48/92 (52%), Positives = 56/92 (60%), Gaps = 2/92 (2%) Frame = -2 Query: 408 EDVMEELLQEEILDETDLHIL--NKIRLNSLPWTRXXXXXXXXXXXSQIQWRTPAASTIS 235 EDVMEELLQ EILDETD ++ NKIR+N L + + T S +S Sbjct: 426 EDVMEELLQGEILDETDEYVAVHNKIRINLLSSRTSSGSTGRISVSANLHPITER-SPLS 484 Query: 234 SHFNTPILRSPISPYVPSPLIRPTLYASPGKS 139 ++ TPILRSPI PYV SPL RPTLYASP S Sbjct: 485 TY--TPILRSPIPPYVQSPLERPTLYASPENS 514 >ref|XP_002327610.1| predicted protein [Populus trichocarpa] gi|222836164|gb|EEE74585.1| predicted protein [Populus trichocarpa] Length = 446 Score = 68.6 bits (166), Expect = 5e-10 Identities = 46/95 (48%), Positives = 55/95 (57%), Gaps = 8/95 (8%) Frame = -2 Query: 408 EDVMEELLQEEILDETD--LHILNKIRLNSLPWTRXXXXXXXXXXXSQIQWRTPAASTIS 235 EDVMEEL+QEEILDETD + + NKI +N +P R+P A T S Sbjct: 365 EDVMEELIQEEILDETDEYVDVHNKITINMIP-----------------PRRSPGAGTAS 407 Query: 234 --SHFN----TPILRSPISPYVPSPLIRPTLYASP 148 S ++ +PIL SPI PY SP IRPTLYASP Sbjct: 408 PVSPYHQSPVSPILLSPIPPYAYSPFIRPTLYASP 442 >ref|XP_004140829.1| PREDICTED: DUF21 domain-containing protein At5g52790-like [Cucumis sativus] Length = 490 Score = 66.2 bits (160), Expect = 3e-09 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 11/107 (10%) Frame = -2 Query: 408 EDVMEELLQEEILDETDLHIL--NKIRLNSLPWTRXXXXXXXXXXXSQIQWRTPAASTIS 235 EDVMEELLQEEILDETD ++ NK+++N ++QW +P AS +S Sbjct: 372 EDVMEELLQEEILDETDEYVAVHNKLKVN----MEVRRSTSESPGGPRLQWMSPVASPLS 427 Query: 234 SHF---------NTPILRSPISPYVPSPLIRPTLYASPGKSNLGSPS 121 S+ ++PIL SPI P++ SP P+L +SP SP+ Sbjct: 428 SYHHSPLSSSYNHSPILHSPIPPHIHSPFNPPSLSSSPRNYFHSSPT 474