BLASTX nr result
ID: Cephaelis21_contig00047848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047848 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 emb|CAB10239.1| hypothetical protein [Arabidopsis thaliana] gi|7... 59 3e-07 ref|XP_002890796.1| hypothetical protein ARALYDRAFT_336024 [Arab... 59 5e-07 ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis tha... 57 1e-06 >ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|222856004|gb|EEE93551.1| predicted protein [Populus trichocarpa] Length = 135 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -2 Query: 197 KEREGLSTRQAGASDEIQLRIDPIHGELD*EITSFCKQVRQLR 69 + REGLSTR +SDEIQLRIDPIHG+LD EIT QVRQLR Sbjct: 20 RSREGLSTRPMASSDEIQLRIDPIHGDLDDEITGLRSQVRQLR 62 >ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|222844053|gb|EEE81600.1| predicted protein [Populus trichocarpa] Length = 122 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -2 Query: 197 KEREGLSTRQAGASDEIQLRIDPIHGELD*EITSFCKQVRQLR 69 + REGLSTR +SDEIQLRIDPIH +LD EIT QVRQLR Sbjct: 7 RSREGLSTRPVASSDEIQLRIDPIHWDLDDEITGLRSQVRQLR 49 >emb|CAB10239.1| hypothetical protein [Arabidopsis thaliana] gi|7268166|emb|CAB78502.1| hypothetical protein [Arabidopsis thaliana] Length = 590 Score = 59.3 bits (142), Expect = 3e-07 Identities = 34/65 (52%), Positives = 41/65 (63%) Frame = -2 Query: 197 KEREGLSTRQAGASDEIQLRIDPIHGELD*EITSFCKQVRQLRKCKLFFPIIF*YLCDYL 18 + REGLSTR A S+EIQLRIDP+H +LD EIT QVRQL+ P F Y+ Sbjct: 22 RSREGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKN-----PFGFESGSVYV 76 Query: 17 FFFQN 3 F FQ+ Sbjct: 77 FLFQS 81 >ref|XP_002890796.1| hypothetical protein ARALYDRAFT_336024 [Arabidopsis lyrata subsp. lyrata] gi|297336638|gb|EFH67055.1| hypothetical protein ARALYDRAFT_336024 [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = -2 Query: 191 REGLSTRQAGASDEIQLRIDPIHGELD*EITSFCKQVRQLRKCKLFFPIIF*YLCDYLF 15 REGLSTR A S+EIQLRIDP+H +LD EI QVRQL+ L + C+ LF Sbjct: 36 REGLSTRNASGSEEIQLRIDPMHSDLDDEIIGLHGQVRQLKNIALILSLSIIVECNNLF 94 >ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis thaliana] gi|75248462|sp|Q8VXX9.1|BETL1_ARATH RecName: Full=Bet1-like protein At4g14600 gi|18389246|gb|AAL67066.1| unknown protein [Arabidopsis thaliana] gi|20259643|gb|AAM14339.1| unknown protein [Arabidopsis thaliana] gi|21554084|gb|AAM63165.1| unknown [Arabidopsis thaliana] gi|26452326|dbj|BAC43249.1| unknown protein [Arabidopsis thaliana] gi|332658064|gb|AEE83464.1| protein transport protein SFT1 [Arabidopsis thaliana] Length = 137 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 197 KEREGLSTRQAGASDEIQLRIDPIHGELD*EITSFCKQVRQLR 69 + REGLSTR A S+EIQLRIDP+H +LD EIT QVRQL+ Sbjct: 22 RSREGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLK 64