BLASTX nr result
ID: Cephaelis21_contig00047707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047707 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514556.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 >ref|XP_002514556.1| conserved hypothetical protein [Ricinus communis] gi|223546160|gb|EEF47662.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = +3 Query: 51 GFAVLWNGILLRNVFPRRANVVEQIGAALIIMAVYGLISSVLPNYLLWIP 200 GF WNGI+LR ++PR +N EQIG LI +A + L++ LP L WIP Sbjct: 173 GFTATWNGIMLREMYPRASNATEQIGVTLIFLAFFALVACFLPPKLAWIP 222