BLASTX nr result
ID: Cephaelis21_contig00047655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047655 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262672.1| PREDICTED: oxygen-independent coproporphyrin... 59 5e-07 >ref|XP_002262672.1| PREDICTED: oxygen-independent coproporphyrinogen-III oxidase-like protein sll1917 [Vitis vinifera] Length = 473 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 433 ADEFSYLLSDDCKMSEVLAFLRLSDPDGFLLSNELISHAFSVI 305 +DEFS LLS D + E LAF+RLSDPDGFLLSNELIS AF I Sbjct: 429 SDEFSSLLSKDDGIEERLAFVRLSDPDGFLLSNELISLAFQAI 471