BLASTX nr result
ID: Cephaelis21_contig00047579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047579 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P51409.2|RM05_SOLTU RecName: Full=60S ribosomal protein L5, m... 110 1e-22 ref|YP_717169.1| ribosomal protein L5 [Brassica napus] gi|375911... 110 1e-22 ref|YP_005090480.1| ribosomal protein L5 (mitochondrion) [Lotus ... 110 1e-22 ref|YP_005090465.1| ribosomal protein L5 (mitochondrion) [Millet... 110 1e-22 dbj|BAD83432.2| ribosomal protein L5 (mitochondrion) [Nicotiana ... 110 1e-22 >sp|P51409.2|RM05_SOLTU RecName: Full=60S ribosomal protein L5, mitochondrial Length = 186 Score = 110 bits (275), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 TEFCEFSPELEDHFEIFEHIREFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 159 TEFCEFSPELEDHFEIFEHIR FNVTIVTSANTQDETLLLWSGFLQKDEGETQ Sbjct: 134 TEFCEFSPELEDHFEIFEHIRGFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 186 >ref|YP_717169.1| ribosomal protein L5 [Brassica napus] gi|37591117|dbj|BAC98919.1| ribosomal protein L5 [Brassica napus] Length = 185 Score = 110 bits (275), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 TEFCEFSPELEDHFEIFEHIREFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 159 TEFCEFSPELEDHFEIFEHIR FNVTIVTSANTQDETLLLWSGFLQKDEGETQ Sbjct: 133 TEFCEFSPELEDHFEIFEHIRGFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 185 >ref|YP_005090480.1| ribosomal protein L5 (mitochondrion) [Lotus japonicus] gi|372450312|ref|YP_005090494.1| ribosomal protein L5 (mitochondrion) [Lotus japonicus] gi|357197344|gb|AET62940.1| ribosomal protein L5 (mitochondrion) [Lotus japonicus] gi|357197358|gb|AET62954.1| ribosomal protein L5 (mitochondrion) [Lotus japonicus] Length = 185 Score = 110 bits (275), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 TEFCEFSPELEDHFEIFEHIREFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 159 TEFCEFSPELEDHFEIFEHIR FNVTIVTSANTQDETLLLWSGFLQKDEGETQ Sbjct: 133 TEFCEFSPELEDHFEIFEHIRGFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 185 >ref|YP_005090465.1| ribosomal protein L5 (mitochondrion) [Millettia pinnata] gi|357197328|gb|AET62925.1| ribosomal protein L5 (mitochondrion) [Millettia pinnata] Length = 186 Score = 110 bits (275), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 TEFCEFSPELEDHFEIFEHIREFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 159 TEFCEFSPELEDHFEIFEHIR FNVTIVTSANTQDETLLLWSGFLQKDEGETQ Sbjct: 134 TEFCEFSPELEDHFEIFEHIRGFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 186 >dbj|BAD83432.2| ribosomal protein L5 (mitochondrion) [Nicotiana tabacum] Length = 184 Score = 110 bits (275), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 TEFCEFSPELEDHFEIFEHIREFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 159 TEFCEFSPELEDHFEIFEHIR FNVTIVTSANTQDETLLLWSGFLQKDEGETQ Sbjct: 132 TEFCEFSPELEDHFEIFEHIRGFNVTIVTSANTQDETLLLWSGFLQKDEGETQ 184