BLASTX nr result
ID: Cephaelis21_contig00046822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046822 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555483.1| PREDICTED: uncharacterized protein At5g39865... 62 4e-08 ref|XP_003535476.1| PREDICTED: uncharacterized protein At5g39865... 60 2e-07 ref|XP_003591668.1| Glutaredoxin domain-containing cysteine-rich... 55 6e-06 >ref|XP_003555483.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] Length = 380 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Frame = +1 Query: 220 VRPERILQVNASDGFVPNSPPNSNVRAYNHAFSVQEEPKKIVQKCVPAQ-EPEIIDVSEL 396 ++ ERILQ+ ASDG+V P + ++ S + +P+K+VQ+C Q EPE+IDV+EL Sbjct: 19 LKQERILQLKASDGYVDFLPKIPSFNLHSPFVSRENKPEKVVQRCEKMQDEPEVIDVAEL 78 Query: 397 MKDLEDQD 420 MKDLE+++ Sbjct: 79 MKDLEEEE 86 >ref|XP_003535476.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] Length = 343 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +1 Query: 220 VRPERILQVNASDGFVPNSPPNSNVRAYNHAFSVQEEPKKIVQKCVPAQ-EPEIIDVSEL 396 ++ + ILQ+ ASDG+V P + ++ S + +P+K+VQ C Q EPE+IDV+EL Sbjct: 19 LKQDLILQIKASDGYVHFLPKIPSFNLHSPFVSRENKPEKVVQSCEKMQDEPEVIDVAEL 78 Query: 397 MKDLEDQD 420 MKDLE++D Sbjct: 79 MKDLEEED 86 >ref|XP_003591668.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|358346057|ref|XP_003637089.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|355480716|gb|AES61919.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|355503024|gb|AES84227.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] Length = 369 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +1 Query: 217 YVRPERILQVNASDGFVPNSPPNSNVRAYNHAFSVQEEPKKIVQKCVPAQ-EPEIIDVSE 393 Y+ P+RILQV + DG+ P S+ N S + E KK + Q +PEIIDVSE Sbjct: 20 YLMPDRILQVKSIDGYADFLPKISSFNIPNPFVSRENESKKSCENLQEEQPQPEIIDVSE 79 Query: 394 LMKDLEDQDAEL 429 LMKDLE+ + ++ Sbjct: 80 LMKDLEENEEQM 91