BLASTX nr result
ID: Cephaelis21_contig00046775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046775 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA10289.1| hypothetical protein [Cicer arietinum] 57 2e-06 ref|XP_003554323.1| PREDICTED: hypersensitive-induced response p... 57 2e-06 ref|NP_001236736.1| uncharacterized protein LOC100306559 [Glycin... 57 2e-06 gb|AEA86339.1| PPLZ [Solanum nigrum] 56 3e-06 ref|XP_002961855.1| hypothetical protein SELMODRAFT_140325 [Sela... 56 3e-06 >emb|CAA10289.1| hypothetical protein [Cicer arietinum] Length = 286 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 93 VIRACVPKLELDSVFEQKNEIAKAVEDELEK 1 VIRA VPKLELD+VFEQKN+IAKAVEDELEK Sbjct: 104 VIRASVPKLELDAVFEQKNDIAKAVEDELEK 134 >ref|XP_003554323.1| PREDICTED: hypersensitive-induced response protein 1-like [Glycine max] Length = 286 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 93 VIRACVPKLELDSVFEQKNEIAKAVEDELEK 1 VIRA VPKLELDSVFEQKN+IAKAVE+ELEK Sbjct: 104 VIRASVPKLELDSVFEQKNDIAKAVEEELEK 134 >ref|NP_001236736.1| uncharacterized protein LOC100306559 [Glycine max] gi|255628879|gb|ACU14784.1| unknown [Glycine max] Length = 245 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 93 VIRACVPKLELDSVFEQKNEIAKAVEDELEK 1 VIRA VPKLELDSVFEQKN+IAKAVE+ELEK Sbjct: 104 VIRASVPKLELDSVFEQKNDIAKAVEEELEK 134 >gb|AEA86339.1| PPLZ [Solanum nigrum] Length = 184 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 93 VIRACVPKLELDSVFEQKNEIAKAVEDELEK 1 VIRA VPKL LD VFEQKNEIAKAVEDELEK Sbjct: 47 VIRASVPKLNLDDVFEQKNEIAKAVEDELEK 77 >ref|XP_002961855.1| hypothetical protein SELMODRAFT_140325 [Selaginella moellendorffii] gi|302798074|ref|XP_002980797.1| hypothetical protein SELMODRAFT_154087 [Selaginella moellendorffii] gi|300151336|gb|EFJ17982.1| hypothetical protein SELMODRAFT_154087 [Selaginella moellendorffii] gi|300170514|gb|EFJ37115.1| hypothetical protein SELMODRAFT_140325 [Selaginella moellendorffii] Length = 286 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 93 VIRACVPKLELDSVFEQKNEIAKAVEDELEK 1 V+RACVPK+ LD VFEQKNE+AK+VEDELEK Sbjct: 104 VVRACVPKMILDDVFEQKNEVAKSVEDELEK 134