BLASTX nr result
ID: Cephaelis21_contig00046737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046737 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590736.1| hypothetical protein MTR_1g073220 [Medicago ... 64 1e-08 >ref|XP_003590736.1| hypothetical protein MTR_1g073220 [Medicago truncatula] gi|355479784|gb|AES60987.1| hypothetical protein MTR_1g073220 [Medicago truncatula] Length = 361 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/74 (32%), Positives = 41/74 (55%) Frame = -2 Query: 404 KNTLSALWSLLGKFKLRELGHNLYQFMFDSMADLKQILNGKVWTFKSQYLLLKPWNEDVD 225 +N LS +W F++ +G L+ F D D K+I+ G W F++ +L++ PW D+D Sbjct: 102 QNALSNIWCNPKGFRVEHIGDKLFHFFMDEQEDTKRIIRGNPWFFRNSWLIVHPWRRDID 161 Query: 224 YKQINFNSVFLWVQ 183 + + F +WVQ Sbjct: 162 ARSLEFRHAPIWVQ 175