BLASTX nr result
ID: Cephaelis21_contig00046505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046505 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617314.1| protease inhibitor [Medicago truncatula] gi|... 57 1e-06 >ref|XP_003617314.1| protease inhibitor [Medicago truncatula] gi|355518649|gb|AET00273.1| protease inhibitor [Medicago truncatula] Length = 70 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -3 Query: 299 VAVVTIEEDNHNVRAIIVDEDAFVTADLNCGRVRVFVDKYGFVVKTPVVG 150 VA TI+ +N V AIIV E +FVTAD C RVRV+VDK G V + P++G Sbjct: 21 VAEATIQSENPLVNAIIVPEGSFVTADFRCDRVRVWVDKDGIVYQVPIIG 70