BLASTX nr result
ID: Cephaelis21_contig00045479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045479 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266871.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|XP_004160564.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_004136175.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003625900.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] 66 3e-09 >ref|XP_002266871.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 468 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +2 Query: 2 LEPQNGAYYVILSNLYAEMRRWDDVEKIRRLMKEKVLKKDSGSSSVELEYHEDV 163 LEP NGAYYV+LSN+YAEM RW DVEK+RRLMKE L KD G SS+ELE E V Sbjct: 409 LEPGNGAYYVLLSNIYAEMGRWSDVEKVRRLMKEGGLTKDLGCSSIELEPQERV 462 >ref|XP_004160564.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] Length = 464 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = +2 Query: 2 LEPQNGAYYVILSNLYAEMRRWDDVEKIRRLMKEKVLKKDSGSSSVELE 148 +EP+NG YYV+LSN+YAEM +W +VEK+R +MKE+ LKKD GSSSVEL+ Sbjct: 410 MEPENGGYYVVLSNIYAEMGKWSEVEKVREIMKERGLKKDLGSSSVELQ 458 >ref|XP_004136175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] Length = 464 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = +2 Query: 2 LEPQNGAYYVILSNLYAEMRRWDDVEKIRRLMKEKVLKKDSGSSSVELE 148 +EP+NG YYV+LSN+YAEM +W +VEK+R +MKE+ LKKD GSSSVEL+ Sbjct: 410 MEPENGGYYVVLSNIYAEMGKWSEVEKVREIMKERGLKKDLGSSSVELQ 458 >ref|XP_003625900.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500915|gb|AES82118.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 467 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +2 Query: 2 LEPQNGAYYVILSNLYAEMRRWDDVEKIRRLMKEKVLKKDSGSSSVELEYHEDVSKV 172 LEP N AYYV LSNLYAE RW DVE+IR +MKE+ L KD G SSVE+E+ S++ Sbjct: 409 LEPYNTAYYVQLSNLYAEAGRWSDVERIRGMMKERGLTKDLGCSSVEVEHQRHGSEL 465 >emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] Length = 826 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +2 Query: 2 LEPQNGAYYVILSNLYAEMRRWDDVEKIRRLMKEKVLKKDSGSSSVELE 148 L+PQN +YYVILSNLYAE RW DVE++R+L+ EK LKK+ G S +E + Sbjct: 590 LDPQNTSYYVILSNLYAEQGRWGDVERLRKLVDEKGLKKEMGYSMIEAQ 638