BLASTX nr result
ID: Cephaelis21_contig00045423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045423 (576 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase sub... 84 1e-14 ref|XP_002867470.1| hypothetical protein ARALYDRAFT_913717 [Arab... 83 3e-14 ref|NP_194535.2| cytochrome c oxidase, subunit 6b [Arabidopsis t... 83 4e-14 ref|XP_004152624.1| PREDICTED: cytochrome c oxidase subunit 6b-1... 82 8e-14 ref|NP_568867.1| cytochrome c oxidase subunit VIb [Arabidopsis t... 82 8e-14 >ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis sativus] gi|449510814|ref|XP_004163766.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis sativus] Length = 149 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/61 (55%), Positives = 46/61 (75%) Frame = -3 Query: 262 FTNQLRNCCIRYYEFYRCTLENGGNEAKCHKFAEAYRALCPYEWVNKWDEERELGLFPQP 83 FTNQ R+C RY E++RC + G + +C KFA+ YR+LCP EWV KW+E+RELG+FP P Sbjct: 89 FTNQTRHCYARYLEYHRCVQKKGEHAPECKKFAKYYRSLCPGEWVEKWNEQRELGVFPGP 148 Query: 82 I 80 + Sbjct: 149 M 149 >ref|XP_002867470.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. lyrata] gi|297313306|gb|EFH43729.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. lyrata] Length = 78 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -3 Query: 259 TNQLRNCCIRYYEFYRCTLENGGNEAKCHKFAEAYRALCPYEWVNKWDEERELGLFPQPI 80 TNQ R+C RY EF+RCT G + +C +FA+ YRALCP EWV+KW+E+RE G FP P+ Sbjct: 19 TNQTRHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVDKWNEQRETGTFPGPL 78 >ref|NP_194535.2| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana] gi|347602491|sp|Q9SUD3.2|CX6B3_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-3; Short=AtCOX6b-3 gi|332660032|gb|AEE85432.1| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana] Length = 78 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -3 Query: 259 TNQLRNCCIRYYEFYRCTLENGGNEAKCHKFAEAYRALCPYEWVNKWDEERELGLFPQPI 80 TNQ R+C RY EF+RCT G + +C +FA+ YRALCP EWV+KW+E+RE G FP P+ Sbjct: 19 TNQTRHCFTRYIEFHRCTTAKGEDANECERFAKYYRALCPGEWVDKWNEQRETGTFPGPL 78 >ref|XP_004152624.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus] gi|449503913|ref|XP_004162224.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus] Length = 195 Score = 81.6 bits (200), Expect = 8e-14 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 259 TNQLRNCCIRYYEFYRCTLENGGNEAKCHKFAEAYRALCPYEWVNKWDEERELGLFPQPI 80 TNQ R+C RY EF+RCT G +C KFA+ YR+LCP EWV KW+E+RE G FP P+ Sbjct: 136 TNQTRHCFTRYIEFHRCTQAKGEGAPECEKFAKYYRSLCPSEWVEKWNEQRENGTFPGPL 195 >ref|NP_568867.1| cytochrome c oxidase subunit VIb [Arabidopsis thaliana] gi|75164320|sp|Q945L0.1|CX6B2_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-2; Short=AtCOX6b-2 gi|15724312|gb|AAL06549.1|AF412096_1 AT4g28060/T13J8_170 [Arabidopsis thaliana] gi|21360507|gb|AAM47369.1| AT4g28060/T13J8_170 [Arabidopsis thaliana] gi|26450389|dbj|BAC42309.1| unknown protein [Arabidopsis thaliana] gi|110736679|dbj|BAF00303.1| hypothetical protein [Arabidopsis thaliana] gi|332009572|gb|AED96955.1| cytochrome c oxidase subunit VIb [Arabidopsis thaliana] Length = 78 Score = 81.6 bits (200), Expect = 8e-14 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 259 TNQLRNCCIRYYEFYRCTLENGGNEAKCHKFAEAYRALCPYEWVNKWDEERELGLFPQPI 80 TNQ R+C RY EF+RCT G C +FA+ YRALCP EWV+KW+E+RE G FP P+ Sbjct: 19 TNQTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCPGEWVDKWNEQRESGTFPGPL 78