BLASTX nr result
ID: Cephaelis21_contig00045191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045191 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30274.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein... 67 2e-09 sp|Q8S8F2.2|FBL11_ARATH RecName: Full=BTB/POZ domain-containing ... 60 2e-07 dbj|BAE98566.1| hypothetical protein [Arabidopsis thaliana] 60 2e-07 ref|XP_003520688.1| PREDICTED: BTB/POZ domain-containing protein... 57 1e-06 >emb|CBI30274.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +1 Query: 181 DTIVISTSEINGWDLTSILAHKSVRITANRNRIVANSSYFRGLFCGSFSESC 336 D I IST+E + WDL +IL+H+ V++ +NRNR++ +SSYF L CG+F +SC Sbjct: 27 DEIYISTAETSSWDLPTILSHRIVKVQSNRNRLIQHSSYFHSLLCGNFRKSC 78 >ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Vitis vinifera] Length = 980 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +1 Query: 181 DTIVISTSEINGWDLTSILAHKSVRITANRNRIVANSSYFRGLFCGSFSESC 336 D I IST+E + WDL +IL+H+ V++ +NRNR++ +SSYF L CG+F +SC Sbjct: 27 DEIYISTAETSSWDLPTILSHRIVKVQSNRNRLIQHSSYFHSLLCGNFRKSC 78 >sp|Q8S8F2.2|FBL11_ARATH RecName: Full=BTB/POZ domain-containing protein FBL11 Length = 940 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = +1 Query: 169 QDD----LDTIVISTSEINGWDLTSILAHKSVRITANRNRIVANSSYFRGLFCGSFSES 333 QDD + I IS SEI WD++ IL++ SV++ A+R R++ SSYF GL GSFSES Sbjct: 21 QDDASSSIQEISISASEIASWDMSEILSYGSVKVRAHRTRLIQESSYFHGLLSGSFSES 79 >dbj|BAE98566.1| hypothetical protein [Arabidopsis thaliana] Length = 931 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = +1 Query: 169 QDD----LDTIVISTSEINGWDLTSILAHKSVRITANRNRIVANSSYFRGLFCGSFSES 333 QDD + I IS SEI WD++ IL++ SV++ A+R R++ SSYF GL GSFSES Sbjct: 12 QDDASSSIQEISISASEIASWDMSEILSYGSVKVRAHRTRLIQESSYFHGLLSGSFSES 70 >ref|XP_003520688.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Glycine max] Length = 982 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/91 (32%), Positives = 46/91 (50%) Frame = +1 Query: 64 VDEEDDGEFVILKCIDPTPNRVXXXXXXXXXXXXFQDDLDTIVISTSEINGWDLTSILAH 243 V ++ D E VIL C + P D I++S +++ WDL + L Sbjct: 3 VSDDVDDEHVILLCTNTDPIETTETLN------------DEILVSATDVLAWDLPTTLTF 50 Query: 244 KSVRITANRNRIVANSSYFRGLFCGSFSESC 336 ++++ +RNR++ S YFRGL SFSESC Sbjct: 51 PTIKVQTHRNRLIERSLYFRGLLSRSFSESC 81