BLASTX nr result
ID: Cephaelis21_contig00045131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045131 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515981.1| GATA transcription factor, putative [Ricinus... 72 4e-11 ref|XP_002283745.1| PREDICTED: GATA transcription factor 9 [Viti... 58 9e-07 ref|XP_002284028.1| PREDICTED: GATA transcription factor 9 [Viti... 55 6e-06 >ref|XP_002515981.1| GATA transcription factor, putative [Ricinus communis] gi|223544886|gb|EEF46401.1| GATA transcription factor, putative [Ricinus communis] Length = 338 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 7/53 (13%) Frame = +1 Query: 184 METPEFFQAGYYN-------AQFTPEKRLSDAKNGDHFLIDDLLDFPNDDGMA 321 ME PEFF GYY+ A+F PEKR+SD KNGDHF +DDLLDFPNDD A Sbjct: 1 MEAPEFFIGGYYSGGAASTAAEFLPEKRMSDQKNGDHFAVDDLLDFPNDDDAA 53 >ref|XP_002283745.1| PREDICTED: GATA transcription factor 9 [Vitis vinifera] gi|147811360|emb|CAN61228.1| hypothetical protein VITISV_004677 [Vitis vinifera] Length = 342 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 5/50 (10%) Frame = +1 Query: 184 METPEFFQAGYYNA---QFTPEKRLSDAK--NGDHFLIDDLLDFPNDDGM 318 ME PEFFQ G+ A QF EKR+SD K GDHF+I+DLLDF NDD + Sbjct: 1 MEAPEFFQGGFCIAPASQFGTEKRISDTKPGGGDHFIIEDLLDFSNDDAV 50 >ref|XP_002284028.1| PREDICTED: GATA transcription factor 9 [Vitis vinifera] Length = 329 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +1 Query: 184 METPEFFQAGYYNA---QFTPEKRLSDAKNGDHFLIDDLLDFPNDD 312 ME FF GYY+A +F+ EKR + K GDHFL++DLLDFPNDD Sbjct: 1 MEASSFFPGGYYSAGADEFSQEKR--EQKPGDHFLVEDLLDFPNDD 44