BLASTX nr result
ID: Cephaelis21_contig00044967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044967 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281487.1| PREDICTED: cyclin-SDS-like [Vitis vinifera] 60 2e-07 emb|CAN78702.1| hypothetical protein VITISV_034263 [Vitis vinifera] 60 2e-07 >ref|XP_002281487.1| PREDICTED: cyclin-SDS-like [Vitis vinifera] Length = 605 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Frame = -1 Query: 210 YTPSIWYDSGSQFSEKSINDESPSPNFQLFVQYSREFCKSSFAFDSNPEGSSPLVDSH-- 37 YTPS++++SGS+FSE+S D + SP F LFVQY+++F + + D+ SS LV + Sbjct: 305 YTPSLFFESGSEFSERSEGDSTRSPTFSLFVQYNQQFSRLASRLDARV--SSSLVQNEYR 362 Query: 36 -EITLLGLEEKD 4 E TLL E++D Sbjct: 363 DEFTLLRFEDED 374 >emb|CAN78702.1| hypothetical protein VITISV_034263 [Vitis vinifera] Length = 626 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Frame = -1 Query: 210 YTPSIWYDSGSQFSEKSINDESPSPNFQLFVQYSREFCKSSFAFDSNPEGSSPLVDSH-- 37 YTPS++++SGS+FSE+S D + SP F LFVQY+++F + + D+ SS LV + Sbjct: 305 YTPSLFFESGSEFSERSEGDSTRSPTFSLFVQYNQQFSRLASRLDARV--SSSLVQNEYR 362 Query: 36 -EITLLGLEEKD 4 E TLL E++D Sbjct: 363 DEFTLLRFEDED 374