BLASTX nr result
ID: Cephaelis21_contig00044845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044845 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530679.1| DNA helicase hus2, putative [Ricinus communi... 59 5e-07 >ref|XP_002530679.1| DNA helicase hus2, putative [Ricinus communis] gi|223529772|gb|EEF31710.1| DNA helicase hus2, putative [Ricinus communis] Length = 1233 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +3 Query: 156 MTMNNTVKQGGNYSAECSKIQNRLTENNWSQHAKVYNNFASQEKFLNSNFLFSLSAQ 326 MT N ++Q + SAE K +L + NWSQH K ++NF+ Q+KFL+SNFL+SL Q Sbjct: 1 MTRENHMRQNLSISAEGFKCDEKLPKINWSQHDKAHDNFSCQKKFLSSNFLYSLENQ 57