BLASTX nr result
ID: Cephaelis21_contig00044830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044830 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517660.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002517660.1| conserved hypothetical protein [Ricinus communis] gi|223543292|gb|EEF44824.1| conserved hypothetical protein [Ricinus communis] Length = 257 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = +3 Query: 51 PVKLPTSKAEWVEAMITEMMGSRSVDDAKSRAARLFEFLEEFXXXXXXXXXXXXXRE--- 221 P LP AEWV+ ++ EMM + SVDDAKSRA+R+ E LE+ + Sbjct: 115 PTNLPVDGAEWVDLLVREMMSATSVDDAKSRASRVLEALEKSIHMHAADETAQSFEKESV 174 Query: 222 -FRERIETLAKENSIL 266 +E+IE L ++N+IL Sbjct: 175 MLKEQIEALIRDNTIL 190