BLASTX nr result
ID: Cephaelis21_contig00044772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044772 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65723.1| hypothetical protein VITISV_004446 [Vitis vinifera] 60 2e-07 ref|XP_004138869.1| PREDICTED: 6-hydroxynicotinate 3-monooxygena... 60 2e-07 ref|XP_002282242.1| PREDICTED: 6-hydroxynicotinate 3-monooxygena... 60 2e-07 ref|XP_002514357.1| monoxygenase, putative [Ricinus communis] gi... 57 1e-06 >emb|CAN65723.1| hypothetical protein VITISV_004446 [Vitis vinifera] Length = 162 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 223 LSLADCHPFDPRTASPEDCEELQQNNMPFFNDVPSILN 110 L LAD PFDP+TAS EDCEELQQ NMPFF D+P LN Sbjct: 124 LILADREPFDPKTASLEDCEELQQKNMPFFADIPLPLN 161 >ref|XP_004138869.1| PREDICTED: 6-hydroxynicotinate 3-monooxygenase-like [Cucumis sativus] gi|449499632|ref|XP_004160869.1| PREDICTED: 6-hydroxynicotinate 3-monooxygenase-like [Cucumis sativus] Length = 433 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 223 LSLADCHPFDPRTASPEDCEELQQNNMPFFNDVPSILN 110 L+L D PFDPR A+PE+C ELQQ NMPFFNDVP +++ Sbjct: 386 LALPDREPFDPRVATPENCLELQQKNMPFFNDVPQLID 423 >ref|XP_002282242.1| PREDICTED: 6-hydroxynicotinate 3-monooxygenase [Vitis vinifera] Length = 424 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 223 LSLADCHPFDPRTASPEDCEELQQNNMPFFNDVPSILN 110 L LAD PFDP+TAS EDCEELQQ NMPFF D+P LN Sbjct: 386 LILADRKPFDPKTASLEDCEELQQKNMPFFADIPLPLN 423 >ref|XP_002514357.1| monoxygenase, putative [Ricinus communis] gi|223546813|gb|EEF48311.1| monoxygenase, putative [Ricinus communis] Length = 420 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 223 LSLADCHPFDPRTASPEDCEELQQNNMPFFNDVPSI 116 LSL D PFDP+TA+PEDCEELQ NMPFF VP + Sbjct: 382 LSLPDRKPFDPKTATPEDCEELQDKNMPFFAGVPGL 417