BLASTX nr result
ID: Cephaelis21_contig00044676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044676 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomen... 78 8e-26 ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|2... 75 2e-24 ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus tr... 74 6e-24 ref|XP_002863306.1| predicted protein [Arabidopsis lyrata subsp.... 64 5e-21 ref|XP_003588932.1| hypothetical protein MTR_1g015430 [Medicago ... 103 1e-20 >ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomentosiformis] gi|81301638|ref|YP_398933.1| hypothetical protein NitoCp122 [Nicotiana tomentosiformis] gi|351653934|ref|YP_004891660.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653949|ref|YP_004891676.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|76559646|emb|CAJ32484.1| hypothetical protein [Nicotiana tabacum] gi|76559648|emb|CAJ32486.1| hypothetical protein [Nicotiana tabacum] gi|77799619|dbj|BAE46708.1| hypothetical protein [Nicotiana sylvestris] gi|77799635|dbj|BAE46724.1| hypothetical protein [Nicotiana sylvestris] gi|80750981|dbj|BAE48057.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750997|dbj|BAE48073.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453960|gb|AEO95618.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453975|gb|AEO95633.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454070|gb|AEO95727.1| hypothetical protein [synthetic construct] gi|347454085|gb|AEO95742.1| hypothetical protein [synthetic construct] Length = 71 Score = 77.8 bits (190), Expect(2) = 8e-26 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 301 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVILQRLVKVRKRG 176 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVI QRL +VRK+G Sbjct: 1 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVISQRLARVRKKG 42 Score = 64.3 bits (155), Expect(2) = 8e-26 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 188 KEEGGTNTLGERSTTESCMLRSGRMNRSRKGIY 90 +++GGT+TLGERSTTESCMLRSGRMNRSRKGIY Sbjct: 39 RKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 71 >ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|222857709|gb|EEE95256.1| predicted protein [Populus trichocarpa] Length = 71 Score = 75.5 bits (184), Expect(2) = 2e-24 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 301 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVILQRLVKVRKRG 176 MGAGLKKDLRVS+VGPGGSLNAFFFLLIGVI +RLV VRK+G Sbjct: 1 MGAGLKKDLRVSKVGPGGSLNAFFFLLIGVISKRLVMVRKKG 42 Score = 62.0 bits (149), Expect(2) = 2e-24 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 188 KEEGGTNTLGERSTTESCMLRSGRMNRSRKGIY 90 +++GGT+TLGERST ESCMLRSGRMNRSRKGIY Sbjct: 39 RKKGGTSTLGERSTPESCMLRSGRMNRSRKGIY 71 >ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus trichocarpa] gi|134093266|ref|YP_001109567.1| hypothetical protein Poptr_cp089 [Populus trichocarpa] gi|133712113|gb|ABO36756.1| conserved hypothetical protein [Populus trichocarpa] gi|133712128|gb|ABO36771.1| conserved hypothetical protein [Populus trichocarpa] Length = 71 Score = 73.9 bits (180), Expect(2) = 6e-24 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 301 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVILQRLVKVRKRG 176 MGAGLKKDLRVS+VGPGGSLNAFFFLLIGVI +RL VRK+G Sbjct: 1 MGAGLKKDLRVSKVGPGGSLNAFFFLLIGVISKRLAMVRKKG 42 Score = 62.0 bits (149), Expect(2) = 6e-24 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 188 KEEGGTNTLGERSTTESCMLRSGRMNRSRKGIY 90 +++GGT+TLGERST ESCMLRSGRMNRSRKGIY Sbjct: 39 RKKGGTSTLGERSTPESCMLRSGRMNRSRKGIY 71 >ref|XP_002863306.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309140|gb|EFH39565.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 71 Score = 63.9 bits (154), Expect(2) = 5e-21 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 188 KEEGGTNTLGERSTTESCMLRSGRMNRSRKGIY 90 ++ GGT+TLGERSTTESCMLRSGRMNRSRKGIY Sbjct: 39 RKRGGTSTLGERSTTESCMLRSGRMNRSRKGIY 71 Score = 62.0 bits (149), Expect(2) = 5e-21 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -3 Query: 301 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVILQRLVKVRKRG 176 MGAGLKKDLRVSRV P GSLNA FFLLI VI Q L VRKRG Sbjct: 1 MGAGLKKDLRVSRVRPVGSLNALFFLLIEVISQILPMVRKRG 42 >ref|XP_003588932.1| hypothetical protein MTR_1g015430 [Medicago truncatula] gi|355477980|gb|AES59183.1| hypothetical protein MTR_1g015430 [Medicago truncatula] Length = 219 Score = 103 bits (257), Expect = 1e-20 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +2 Query: 35 LAREVNHRTYGPTNWERIDRFLFGSDSSFPNAAYNSPLYCALQVCLFPPLPYLDK 199 LAR+VNHRTYGP+NW+RI++FLFGSDSSFPNA YN PLYC+LQVCLFP LPY DK Sbjct: 126 LARKVNHRTYGPSNWKRINKFLFGSDSSFPNATYNYPLYCSLQVCLFPLLPYHDK 180