BLASTX nr result
ID: Cephaelis21_contig00044578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044578 (699 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] 75 2e-11 ref|XP_002877249.1| hypothetical protein ARALYDRAFT_484760 [Arab... 75 2e-11 gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] 75 2e-11 gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] 75 2e-11 ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] ... 75 2e-11 >gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] Length = 420 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 GGSLLASSPDFETMCVTKAEYEELGSARCRRRFFH 105 GGSLLASSPDFE+MCVTKAEYEELGSARCRRRFFH Sbjct: 386 GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >ref|XP_002877249.1| hypothetical protein ARALYDRAFT_484760 [Arabidopsis lyrata subsp. lyrata] gi|297323087|gb|EFH53508.1| hypothetical protein ARALYDRAFT_484760 [Arabidopsis lyrata subsp. lyrata] Length = 420 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 GGSLLASSPDFETMCVTKAEYEELGSARCRRRFFH 105 GGSLLASSPDFE+MCVTKAEYEELGSARCRRRFFH Sbjct: 386 GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] Length = 421 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 GGSLLASSPDFETMCVTKAEYEELGSARCRRRFFH 105 GGSLLASSPDFE+MCVTKAEYEELGSARCRRRFFH Sbjct: 387 GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421 >gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] Length = 378 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 GGSLLASSPDFETMCVTKAEYEELGSARCRRRFFH 105 GGSLLASSPDFE+MCVTKAEYEELGSARCRRRFFH Sbjct: 344 GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 378 >ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] gi|75301409|sp|Q8LGE3.1|ARP6_ARATH RecName: Full=Actin-related protein 6; AltName: Full=Protein EARLY IN SHORT DAYS 1; AltName: Full=Protein SUPPRESSOR OF FRIGIDA 3 gi|21489924|tpg|DAA00030.1| TPA_exp: actin-related protein 6; AtARP6 [Arabidopsis thaliana] gi|21536575|gb|AAM60907.1| putative actin [Arabidopsis thaliana] gi|23297435|gb|AAN12968.1| putative actin [Arabidopsis thaliana] gi|332644195|gb|AEE77716.1| actin-related protein 6 [Arabidopsis thaliana] Length = 421 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 GGSLLASSPDFETMCVTKAEYEELGSARCRRRFFH 105 GGSLLASSPDFE+MCVTKAEYEELGSARCRRRFFH Sbjct: 387 GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421