BLASTX nr result
ID: Cephaelis21_contig00044563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044563 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002317063.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854... 58 7e-07 ref|XP_003605638.1| hypothetical protein MTR_4g035220 [Medicago ... 58 7e-07 ref|XP_003540561.1| PREDICTED: protein prune homolog [Glycine max] 57 2e-06 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 293 LPLKALHHPDLRGEMKAFEINKVTSRKTIERLLEEFIEISK 171 LPLK LH P L+ EM+ FEI+K+TSRKTIERLLEEF SK Sbjct: 535 LPLKVLHQPGLKDEMRVFEIDKITSRKTIERLLEEFTAASK 575 >ref|XP_002317063.1| predicted protein [Populus trichocarpa] gi|222860128|gb|EEE97675.1| predicted protein [Populus trichocarpa] Length = 604 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 302 AHDLPLKALHHPDLRGEMKAFEINKVTSRKTIERLLEEFIEISK 171 A LPLKA++ P LR +MKAFEI+K TSRKTIERLLEEF SK Sbjct: 560 ASHLPLKAMNRPGLRDDMKAFEIDKATSRKTIERLLEEFGGASK 603 >ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854333 [Vitis vinifera] Length = 1689 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 302 AHDLPLKALHHPDLRGEMKAFEINKVTSRKTIERLLEEFIEISK 171 A LPLK LH P LR EM+AFE+++VTSR+TIE+LL+EF SK Sbjct: 1645 ASQLPLKVLHQPGLRDEMRAFEVDQVTSRRTIEQLLDEFGGTSK 1688 >ref|XP_003605638.1| hypothetical protein MTR_4g035220 [Medicago truncatula] gi|355506693|gb|AES87835.1| hypothetical protein MTR_4g035220 [Medicago truncatula] Length = 213 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 302 AHDLPLKALHHPDLRGEMKAFEINKVTSRKTIERLLEEFIEISK 171 A LPLK LH P L EMKA+EI+KVTSRK +E L+EEF+ I K Sbjct: 169 ASRLPLKILHFPGLNNEMKAYEIDKVTSRKIVENLIEEFVGIPK 212 >ref|XP_003540561.1| PREDICTED: protein prune homolog [Glycine max] Length = 526 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 302 AHDLPLKALHHPDLRGEMKAFEINKVTSRKTIERLLEEFIEISK 171 A LPLK+LH P L+ MKA+EI+K+TSRK +E L+EEF+ I K Sbjct: 482 ASRLPLKSLHFPGLKNGMKAYEIDKITSRKIVEHLIEEFVGIPK 525