BLASTX nr result
ID: Cephaelis21_contig00043325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043325 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24067.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002266058.1| PREDICTED: microtubule-associated protein SP... 64 2e-08 ref|XP_004139086.1| PREDICTED: microtubule-associated protein TO... 56 3e-06 ref|NP_178730.2| armadillo/beta-catenin-like repeat-containing p... 56 3e-06 gb|AAC69120.1| hypothetical protein [Arabidopsis thaliana] 56 3e-06 >emb|CBI24067.3| unnamed protein product [Vitis vinifera] Length = 831 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 112 KGKGTARVNGQQVAFELKQRVVLALNKIADRDTYQIG 2 K KGT RVN QQV FELK RVVLALNK+ADRDTYQIG Sbjct: 8 KAKGTTRVNTQQVIFELKHRVVLALNKLADRDTYQIG 44 >ref|XP_002266058.1| PREDICTED: microtubule-associated protein SPIRAL2-like [Vitis vinifera] Length = 838 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 112 KGKGTARVNGQQVAFELKQRVVLALNKIADRDTYQIG 2 K KGT RVN QQV FELK RVVLALNK+ADRDTYQIG Sbjct: 8 KAKGTTRVNTQQVIFELKHRVVLALNKLADRDTYQIG 44 >ref|XP_004139086.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] gi|449476175|ref|XP_004154662.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] Length = 828 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 112 KGKGTARVNGQQVAFELKQRVVLALNKIADRDTYQIG 2 KG+ +V QQ+ FELKQ+VV ALNK+ADRDTYQIG Sbjct: 9 KGRAPTKVTAQQLVFELKQKVVFALNKLADRDTYQIG 45 >ref|NP_178730.2| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|330250943|gb|AEC06037.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 820 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -3 Query: 142 MEMGPEFRGRKGKGTARVNGQQVAFELKQRVVLALNKIADRDTYQIG 2 M+ + +GR G A N QQV FELK++VV+ALNK+ADRDTYQ G Sbjct: 1 MKTNMQVKGRGGNMKANTNTQQVIFELKKKVVIALNKLADRDTYQRG 47 >gb|AAC69120.1| hypothetical protein [Arabidopsis thaliana] Length = 893 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -3 Query: 142 MEMGPEFRGRKGKGTARVNGQQVAFELKQRVVLALNKIADRDTYQIG 2 M+ + +GR G A N QQV FELK++VV+ALNK+ADRDTYQ G Sbjct: 1 MKTNMQVKGRGGNMKANTNTQQVIFELKKKVVIALNKLADRDTYQRG 47