BLASTX nr result
ID: Cephaelis21_contig00043110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043110 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516439.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >ref|XP_002516439.1| conserved hypothetical protein [Ricinus communis] gi|223544259|gb|EEF45780.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/70 (41%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = -2 Query: 209 DVETEQG-LEVSLVDGVNSLTISERYDNQIANPWRTSVVVRLLGRFVGYKVLCSKIDKLW 33 D+E ++G + V L ++ +S+ + N+I PW SVVV+L GR +GYK+LC++I +W Sbjct: 29 DIEFKEGDITVHLEPSGPTVMLSDEFRNRIKQPWENSVVVKLWGRPLGYKMLCNRIMTIW 88 Query: 32 NLKGNYRVHD 3 L+G+Y+V D Sbjct: 89 KLRGHYKVID 98