BLASTX nr result
ID: Cephaelis21_contig00042532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042532 (522 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-16 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 89 5e-16 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 84 1e-14 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/84 (47%), Positives = 58/84 (69%) Frame = +2 Query: 266 MAVQVNSVTPVQNSLSILSRNYCGFSKEVPKFQYFRLKKDFPVLLASREMAIAPKDGVFT 445 MA+ VN+++P+ + +R CGF +VP L K F +LAS ++ I+PKD VFT Sbjct: 1 MAILVNAMSPITSPSPENARKVCGFFSQVPNLHTLSLNKGFSRVLASTQITISPKDNVFT 60 Query: 446 LPNWRSGNDDQRTKEIRMSDAFLY 517 LPNWRSG +D RT+++R++DAFLY Sbjct: 61 LPNWRSGKNDPRTRDLRLNDAFLY 84 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/84 (48%), Positives = 57/84 (67%) Frame = +2 Query: 266 MAVQVNSVTPVQNSLSILSRNYCGFSKEVPKFQYFRLKKDFPVLLASREMAIAPKDGVFT 445 MA V+SV+P+ N + +R CGF +P F L KDF +LAS ++ I+PKD V T Sbjct: 1 MASLVHSVSPLTNPFTEAARIACGFFSHIPNLHSFSLNKDFTRVLASTQITISPKDSVIT 60 Query: 446 LPNWRSGNDDQRTKEIRMSDAFLY 517 LPNWRSG +DQR +++R+SDAF + Sbjct: 61 LPNWRSGKNDQRNRDMRISDAFFH 84 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/84 (42%), Positives = 57/84 (67%) Frame = +2 Query: 266 MAVQVNSVTPVQNSLSILSRNYCGFSKEVPKFQYFRLKKDFPVLLASREMAIAPKDGVFT 445 MA +N+V+P+ N+ +R CGF +P Q L K F +LAS ++ I+PKD +FT Sbjct: 1 MATLLNTVSPITNTSPETTRRGCGFFSHIPNLQKLSLNKGFSKVLASTQITISPKDTIFT 60 Query: 446 LPNWRSGNDDQRTKEIRMSDAFLY 517 LPNW++G +Q++KE+R++DAF + Sbjct: 61 LPNWKTGKVEQKSKELRLTDAFFH 84 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/84 (44%), Positives = 55/84 (65%) Frame = +2 Query: 266 MAVQVNSVTPVQNSLSILSRNYCGFSKEVPKFQYFRLKKDFPVLLASREMAIAPKDGVFT 445 MA +N+V+P+ N +R CGF +P Q L K F +LAS ++ I+PKD +FT Sbjct: 1 MATLLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDTIFT 60 Query: 446 LPNWRSGNDDQRTKEIRMSDAFLY 517 LPNW+ G DQ++KE+R++DAF + Sbjct: 61 LPNWKIGKLDQKSKELRLNDAFFH 84 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/84 (44%), Positives = 55/84 (65%) Frame = +2 Query: 266 MAVQVNSVTPVQNSLSILSRNYCGFSKEVPKFQYFRLKKDFPVLLASREMAIAPKDGVFT 445 MA +N+V+P+ N +R CGF +P Q L K F +LAS ++ I+PKD +FT Sbjct: 1 MATLLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDTIFT 60 Query: 446 LPNWRSGNDDQRTKEIRMSDAFLY 517 LPNW+ G DQ++KE+R++DAF + Sbjct: 61 LPNWKIGKLDQKSKELRLNDAFFH 84