BLASTX nr result
ID: Cephaelis21_contig00042489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042489 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526809.1| PREDICTED: potassium transporter 2-like [Gly... 91 1e-16 ref|XP_003523274.1| PREDICTED: potassium transporter 2-like [Gly... 91 1e-16 emb|CBI25380.3| unnamed protein product [Vitis vinifera] 90 2e-16 ref|XP_002279573.1| PREDICTED: potassium transporter 2 [Vitis vi... 90 2e-16 emb|CAN75526.1| hypothetical protein VITISV_043599 [Vitis vinifera] 90 2e-16 >ref|XP_003526809.1| PREDICTED: potassium transporter 2-like [Glycine max] Length = 790 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 167 SLAESVRYPVMIIAILASVIGSQAIISGTFSIINQSQSLGCFPRVKVVHTQE 12 S+ ESVR+PV+I+AILASV+GSQAIISGTFSIINQSQSLGCFPRVKVVHT + Sbjct: 331 SVPESVRWPVLILAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSD 382 >ref|XP_003523274.1| PREDICTED: potassium transporter 2-like [Glycine max] Length = 790 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 167 SLAESVRYPVMIIAILASVIGSQAIISGTFSIINQSQSLGCFPRVKVVHTQE 12 S+ ESVR+PV+I+AILASV+GSQAIISGTFSIINQSQSLGCFPRVKVVHT + Sbjct: 331 SVPESVRWPVLILAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSD 382 >emb|CBI25380.3| unnamed protein product [Vitis vinifera] Length = 766 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 167 SLAESVRYPVMIIAILASVIGSQAIISGTFSIINQSQSLGCFPRVKVVHTQE 12 S+ E+VR+PV+IIAILASV+GSQAIISGTFSIINQSQSLGCFPRVKVVHT + Sbjct: 333 SVPEAVRWPVLIIAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSD 384 >ref|XP_002279573.1| PREDICTED: potassium transporter 2 [Vitis vinifera] Length = 793 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 167 SLAESVRYPVMIIAILASVIGSQAIISGTFSIINQSQSLGCFPRVKVVHTQE 12 S+ E+VR+PV+IIAILASV+GSQAIISGTFSIINQSQSLGCFPRVKVVHT + Sbjct: 333 SVPEAVRWPVLIIAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSD 384 >emb|CAN75526.1| hypothetical protein VITISV_043599 [Vitis vinifera] Length = 794 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 167 SLAESVRYPVMIIAILASVIGSQAIISGTFSIINQSQSLGCFPRVKVVHTQE 12 S+ E+VR+PV+IIAILASV+GSQAIISGTFSIINQSQSLGCFPRVKVVHT + Sbjct: 334 SVPEAVRWPVLIIAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSD 385