BLASTX nr result
ID: Cephaelis21_contig00042472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042472 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516692.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002516692.1| conserved hypothetical protein [Ricinus communis] gi|223544187|gb|EEF45711.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = -1 Query: 220 MIKQNVYSVMGNGEKIKFWTDVWIPEVGRLMSHCL-NLDIIDIEATAADLVMPNGEWNWD 44 M K V ++ NGE KFW D WIPE+G L+ H +L I+ + V + +WNW+ Sbjct: 55 MSKSGVIKIVNNGESAKFWIDNWIPELGHLVHHVFRSLSHYLIDGLVKEFVDSSSQWNWN 114 Query: 43 LLETVLELNI 14 +L +L ++ Sbjct: 115 VLNGLLPYHV 124