BLASTX nr result
ID: Cephaelis21_contig00042382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042382 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544860.1| PREDICTED: uncharacterized protein LOC100779... 60 1e-07 ref|XP_002321953.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|NP_974830.1| heavy metal transport/detoxification domain-con... 55 5e-06 ref|XP_002874209.1| hypothetical protein ARALYDRAFT_489321 [Arab... 55 5e-06 ref|NP_001154734.1| heavy metal transport/detoxification domain-... 55 5e-06 >ref|XP_003544860.1| PREDICTED: uncharacterized protein LOC100779431 [Glycine max] Length = 319 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 102 YEQPAVYVIERIPPPQLFSDENPNACCIT 16 Y+ P +YVIERIPPPQLFSDENPNACCIT Sbjct: 291 YQYPPLYVIERIPPPQLFSDENPNACCIT 319 >ref|XP_002321953.1| predicted protein [Populus trichocarpa] gi|222868949|gb|EEF06080.1| predicted protein [Populus trichocarpa] Length = 314 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 108 HEYEQPAVYVIERIPPPQLFSDENPNACCIT 16 H Y+QP +YVIERIPPPQLFSDENPNACCI+ Sbjct: 285 HYYDQP-LYVIERIPPPQLFSDENPNACCIS 314 >ref|NP_974830.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005945|gb|AED93328.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 318 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 102 YEQPAVYVIERIPPPQLFSDENPNACCIT 16 Y QP+ YVIERIPPPQLFSDENPNACCI+ Sbjct: 291 YYQPS-YVIERIPPPQLFSDENPNACCIS 318 >ref|XP_002874209.1| hypothetical protein ARALYDRAFT_489321 [Arabidopsis lyrata subsp. lyrata] gi|297320046|gb|EFH50468.1| hypothetical protein ARALYDRAFT_489321 [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 102 YEQPAVYVIERIPPPQLFSDENPNACCIT 16 Y QP+ YVIERIPPPQLFSDENPNACCI+ Sbjct: 290 YYQPS-YVIERIPPPQLFSDENPNACCIS 317 >ref|NP_001154734.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005946|gb|AED93329.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 316 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 102 YEQPAVYVIERIPPPQLFSDENPNACCIT 16 Y QP+ YVIERIPPPQLFSDENPNACCI+ Sbjct: 289 YYQPS-YVIERIPPPQLFSDENPNACCIS 316