BLASTX nr result
ID: Cephaelis21_contig00042248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042248 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627412.1| Polyphosphoinositide phosphatase [Medicago t... 59 3e-07 >ref|XP_003627412.1| Polyphosphoinositide phosphatase [Medicago truncatula] gi|355521434|gb|AET01888.1| Polyphosphoinositide phosphatase [Medicago truncatula] Length = 914 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 242 YSITKSEMIPISNSTVQSNMAYSKNENRSFVNFACKC 132 Y+ITKSEMIPI + +V+SN+AYSK+ENRS VNF C C Sbjct: 138 YAITKSEMIPIPHPSVRSNLAYSKDENRSLVNFTCTC 174