BLASTX nr result
ID: Cephaelis21_contig00042239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042239 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278762.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_004140461.1| PREDICTED: pentatricopeptide repeat-containi... 39 8e-06 >ref|XP_002278762.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Vitis vinifera] gi|297737070|emb|CBI26271.3| unnamed protein product [Vitis vinifera] Length = 727 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = -2 Query: 299 QRNLVLRQNEKPAFCYALMREDTGSCIGMTKNLQISEGCHNFMKMAHVAFKRSIFNHHRE 120 ++ +VL +EK A CY LMR+ TGSCI + KNL++ E CH F+K+A ++R I R Sbjct: 652 KKEVVLWHSEKLALCYGLMRDGTGSCIRIIKNLRVCEDCHTFIKLASKVYEREIVVRDRT 711 Query: 119 R 117 R Sbjct: 712 R 712 >ref|XP_004140461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Cucumis sativus] Length = 697 Score = 39.3 bits (90), Expect(2) = 8e-06 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 151 SKEASSIIIVRDRTRFHHCRDSCSSCNCLW 62 SK A+ +I+VRD RFHH ++ C SC W Sbjct: 668 SKVANRVIVVRDANRFHHFQNGCCSCGDYW 697 Score = 35.0 bits (79), Expect(2) = 8e-06 Identities = 31/110 (28%), Positives = 48/110 (43%) Frame = -2 Query: 467 NIEEVIKSDAEFQTSEYLIKNNVRR*DLSKXXXXXX*LEKVDYVSHASFCLKKTQ*QRNL 288 N+ V S+ LI NV+ DL + +D V H ++ Q NL Sbjct: 572 NVAHVFTSEDIKHPEANLIYENVK--DLLSKIRPLGYVPDIDNVLHD---IEDEQKVDNL 626 Query: 287 VLRQNEKPAFCYALMREDTGSCIGMTKNLQISEGCHNFMKMAHVAFKRSI 138 +EK A Y LM+ +G+ I + KNL++ + CH +K+ R I Sbjct: 627 SYH-SEKLAVAYGLMKTPSGAPITVIKNLRMCDDCHTAIKLISKVANRVI 675