BLASTX nr result
ID: Cephaelis21_contig00042217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042217 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SST... 80 2e-13 ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical p... 79 4e-13 ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces ... 77 1e-12 ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis... 75 4e-12 ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis... 74 1e-11 >ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] gi|292833481|gb|EFF91830.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] Length = 106 Score = 79.7 bits (195), Expect = 2e-13 Identities = 45/78 (57%), Positives = 47/78 (60%) Frame = -1 Query: 259 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFXXXXXXXX 80 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAF Sbjct: 4 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNRPQL 63 Query: 79 XXXXXXXXTRRSPTQPHR 26 RRSPT R Sbjct: 64 PSGAASPGRRRSPTHHSR 81 >ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302426770|gb|EFK98585.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 103 Score = 79.0 bits (193), Expect = 4e-13 Identities = 45/74 (60%), Positives = 47/74 (63%) Frame = -1 Query: 259 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFXXXXXXXX 80 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAF Sbjct: 1 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNRPPL 60 Query: 79 XXXXXXXXTRRSPT 38 TRRSPT Sbjct: 61 AYAAASPGTRRSPT 74 >ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces sp. C] gi|302535772|ref|ZP_07288114.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444023|gb|EFL15839.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444667|gb|EFL16483.1| conserved hypothetical protein [Streptomyces sp. C] Length = 179 Score = 77.4 bits (189), Expect = 1e-12 Identities = 46/78 (58%), Positives = 49/78 (62%) Frame = -1 Query: 271 GR*QAGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFXXXX 92 GR +AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAF Sbjct: 39 GRFKAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCVSLLMPAFSLVN 98 Query: 91 XXXXXXXXXXXXTRRSPT 38 TRRSPT Sbjct: 99 RPQLASAAASPGTRRSPT 116 >ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291438707|ref|ZP_06578097.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291440884|ref|ZP_06580274.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291340929|gb|EFE67885.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291341602|gb|EFE68558.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291343779|gb|EFE70735.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 75.5 bits (184), Expect = 4e-12 Identities = 44/74 (59%), Positives = 46/74 (62%) Frame = -1 Query: 259 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFXXXXXXXX 80 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAF Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNRPQL 68 Query: 79 XXXXXXXXTRRSPT 38 TRRSPT Sbjct: 69 ASAAASPGTRRSPT 82 >ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291342161|gb|EFE69117.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 73.9 bits (180), Expect = 1e-11 Identities = 43/74 (58%), Positives = 45/74 (60%) Frame = -1 Query: 259 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFXXXXXXXX 80 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL S T +LLMPAF Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSTHTFLTCESLLMPAFSLVNRPQL 68 Query: 79 XXXXXXXXTRRSPT 38 TRRSPT Sbjct: 69 ASAAASPGTRRSPT 82