BLASTX nr result
ID: Cephaelis21_contig00042213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042213 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38805.1| hypothetical protein SDM1_47t00008 [Solanum demis... 59 4e-07 gb|ABD32279.2| reverse transcriptase, putative [Medicago truncat... 45 5e-06 >gb|AAT38805.1| hypothetical protein SDM1_47t00008 [Solanum demissum] Length = 1155 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/71 (40%), Positives = 39/71 (54%) Frame = -3 Query: 213 FLSRRSEVFG*FMKTLNKYEQVLGQKVNKSKSCFIVGNKSTDYLRARVAHTTSFSCHALP 34 F + E F++TL+ YE GQ +NK+KSCF V N + A++ T + P Sbjct: 609 FCNGSKETLEMFLRTLHIYENTSGQLINKNKSCFSVANNAKQNFIAKIKLITCMNHQEFP 668 Query: 33 IKYLGCPLYVG 1 IKYLGCPL G Sbjct: 669 IKYLGCPLISG 679 >gb|ABD32279.2| reverse transcriptase, putative [Medicago truncatula] Length = 480 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 22/59 (37%), Positives = 33/59 (55%) Frame = -3 Query: 177 MKTLNKYEQVLGQKVNKSKSCFIVGNKSTDYLRARVAHTTSFSCHALPIKYLGCPLYVG 1 +K N Y +V Q +N +KS F G +T + + +A T FS +P YLGCP++ G Sbjct: 175 LKFFNDYSEVSAQIINNNKSQFYAGAMTTSHSQM-IAGTLGFSADNIPFFYLGCPIFKG 232 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = -1 Query: 245 THLAYADDVIIFSAGDQRSL 186 TH+ YADDV+IF AG ++++ Sbjct: 152 THILYADDVLIFCAGTKQNI 171