BLASTX nr result
ID: Cephaelis21_contig00042166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042166 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38805.1| hypothetical protein SDM1_47t00008 [Solanum demis... 55 4e-06 >gb|AAT38805.1| hypothetical protein SDM1_47t00008 [Solanum demissum] Length = 1155 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 3/87 (3%) Frame = -2 Query: 304 IISARTDVKKW--PWRFRTELQQINSLIQQMHCRISHGYREVNTVADSLAKMASATRISH 131 I+ A+ + W PWR +++I ++++ I+H RE N AD LA ++ +T ++H Sbjct: 1069 ILLAKAITENWSIPWRMYIPVKKIQKMVEEHGFIINHCLREANQPADKLASISLSTDVNH 1128 Query: 130 SFTS-ESLPSKLKGQVRLDQISYPYLR 53 F S +LPS +KG V LD+++ P R Sbjct: 1129 VFKSYANLPSLVKGLVNLDRMNLPTFR 1155