BLASTX nr result
ID: Cephaelis21_contig00042020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042020 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -3 Query: 214 ALTAFRSTSSKLRSIGRCSKPIREQRARLYIIWRCTVLLLCWQD 83 A A S KLRS RCSK IREQR RLYIIWRCTV+LLCW D Sbjct: 21 AADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 184 KLRSIGRCSKPIREQRARLYIIWRCTVLLLCWQD 83 K RS RCS+ ++EQR RLYIIWRCTV+LL W D Sbjct: 13 KFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46