BLASTX nr result
ID: Cephaelis21_contig00040811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040811 (603 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173495.1| hypothetical protein NitaMp158 [Nicotiana tabac... 75 9e-23 >ref|YP_173495.1| hypothetical protein NitaMp158 [Nicotiana tabacum] gi|56806660|dbj|BAD83561.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 210 Score = 75.1 bits (183), Expect(2) = 9e-23 Identities = 46/90 (51%), Positives = 51/90 (56%) Frame = +3 Query: 177 SGYGLLLIGIDFNLICXXXXXXXXXXXXXXXXXXXXCWEVPIFVISSLCVLVLQDSSLHM 356 S + L+ GID +LI WEVPIFV+ L L L DSSLHM Sbjct: 44 SYFFFLVFGIDLSLIWGKLKSMLLVRSFRVLLSRLLGWEVPIFVLVFLVGLEL-DSSLHM 102 Query: 357 KAENDSPSSKDSTEAQVGSPLGEERDEGHG 446 + ENDSPSSKDS EAQV SPLGEERD G Sbjct: 103 RPENDSPSSKDSKEAQVSSPLGEERDAWKG 132 Score = 57.4 bits (137), Expect(2) = 9e-23 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 440 AWKGKRGLHTSLAFGFKAGPPFQWKRVGY 526 AWKG RG HTS AFGFKAGPPFQWKR Y Sbjct: 129 AWKGNRGRHTSFAFGFKAGPPFQWKRGRY 157