BLASTX nr result
ID: Cephaelis21_contig00040774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040774 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22611.3| unnamed protein product [Vitis vinifera] 82 4e-14 emb|CAN79447.1| hypothetical protein VITISV_037464 [Vitis vinifera] 75 4e-12 ref|XP_002513626.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_003611050.1| hypothetical protein MTR_5g009910 [Medicago ... 63 2e-08 ref|XP_002509872.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >emb|CBI22611.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 82.4 bits (202), Expect = 4e-14 Identities = 41/84 (48%), Positives = 59/84 (70%) Frame = +3 Query: 6 KTKAGWRSTKKLGVTVDLSSNGFPSDVNSRLGSELNSGVLTLNSSAKLDGKVELLFIFKK 185 K +A RSTKK+ VTVD++SN S NS L S++NSG LTL KL+GKV L+ +FKK Sbjct: 215 KARARARSTKKMNVTVDVTSNNVSS--NSNLASDINSGFLTLTGQGKLNGKVHLMKVFKK 272 Query: 186 KKSIEMDCTLTIGVTDRAVRQISC 257 KKS +M+CT+ I + ++ +++ C Sbjct: 273 KKSPQMNCTIKINLENKVIQEWKC 296 >emb|CAN79447.1| hypothetical protein VITISV_037464 [Vitis vinifera] Length = 186 Score = 75.5 bits (184), Expect = 4e-12 Identities = 42/87 (48%), Positives = 57/87 (65%), Gaps = 2/87 (2%) Frame = +3 Query: 6 KTKAGWRSTKKLGVTVDLSSNGFPSDVNS--RLGSELNSGVLTLNSSAKLDGKVELLFIF 179 K +A RSTK+ +TV +SS S VN+ +L +LNSGVL L+S+AKL GK+ L IF Sbjct: 104 KARARSRSTKRFNITVPISS----SKVNNHRQLRRDLNSGVLNLSSTAKLSGKIHLFKIF 159 Query: 180 KKKKSIEMDCTLTIGVTDRAVRQISCK 260 KKKKS EM CT+ + ++ +SCK Sbjct: 160 KKKKSAEMSCTMELHTNTSSIENLSCK 186 >ref|XP_002513626.1| conserved hypothetical protein [Ricinus communis] gi|223547534|gb|EEF49029.1| conserved hypothetical protein [Ricinus communis] Length = 217 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/85 (38%), Positives = 54/85 (63%) Frame = +3 Query: 6 KTKAGWRSTKKLGVTVDLSSNGFPSDVNSRLGSELNSGVLTLNSSAKLDGKVELLFIFKK 185 K +A RST+K V L ++ P L S+++SG + L+SS++LDG++ L+ + KK Sbjct: 135 KARARARSTRKFDAIVVLRTDRLPDGFE--LSSDISSGKIPLSSSSRLDGEIHLMKVIKK 192 Query: 186 KKSIEMDCTLTIGVTDRAVRQISCK 260 KKS EM+CT+ + + R ++ I CK Sbjct: 193 KKSAEMNCTMNVDIQTRTLQDIVCK 217 >ref|XP_003611050.1| hypothetical protein MTR_5g009910 [Medicago truncatula] gi|355512385|gb|AES94008.1| hypothetical protein MTR_5g009910 [Medicago truncatula] Length = 189 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/85 (36%), Positives = 48/85 (56%) Frame = +3 Query: 3 PKTKAGWRSTKKLGVTVDLSSNGFPSDVNSRLGSELNSGVLTLNSSAKLDGKVELLFIFK 182 P K R TK + VTVD++ + N + S++ SG+L L S K G V+L+ IF Sbjct: 105 PNDKVSQRKTKHINVTVDVNFLKLIVNGNEKFSSDIGSGMLNLTSYVKFSGIVQLMKIFH 164 Query: 183 KKKSIEMDCTLTIGVTDRAVRQISC 257 K+K++EM C + + T A++ I C Sbjct: 165 KRKTLEMACIMNLNFTSHAIQGIHC 189 >ref|XP_002509872.1| conserved hypothetical protein [Ricinus communis] gi|223549771|gb|EEF51259.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/78 (37%), Positives = 51/78 (65%) Frame = +3 Query: 24 RSTKKLGVTVDLSSNGFPSDVNSRLGSELNSGVLTLNSSAKLDGKVELLFIFKKKKSIEM 203 R T ++ V V++ S+ + + + L S++NSG+L LNS AK G+V LL I KK++S M Sbjct: 144 RDTLRMNVKVEVRSHKYIYN-GTDLTSDINSGILKLNSHAKFSGRVNLLQIAKKRRSASM 202 Query: 204 DCTLTIGVTDRAVRQISC 257 DC+ ++ + R+++ + C Sbjct: 203 DCSFSLDLRSRSIQDLVC 220