BLASTX nr result
ID: Cephaelis21_contig00040728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040728 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_563713.1| self-incompatibility protein S1-like protein [A... 62 6e-08 gb|ABK28382.1| unknown [Arabidopsis thaliana] 62 6e-08 gb|AAM64299.1| unknown [Arabidopsis thaliana] 62 6e-08 emb|CAA60578.1| S3 self-incompatibility protein [Papaver rhoeas]... 57 1e-06 ref|XP_002892231.1| hypothetical protein ARALYDRAFT_887637 [Arab... 57 1e-06 >ref|NP_563713.1| self-incompatibility protein S1-like protein [Arabidopsis thaliana] gi|2494117|gb|AAB80626.1| Contains similarity to Papaver S3 self-incompatibility protein (gb|X87100) [Arabidopsis thaliana] gi|91805739|gb|ABE65598.1| self-incompatibility protein-like protein [Arabidopsis thaliana] gi|109946543|gb|ABG48450.1| At1g04645 [Arabidopsis thaliana] gi|332189607|gb|AEE27728.1| self-incompatibility protein S1-like protein [Arabidopsis thaliana] Length = 128 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +2 Query: 20 PLVIHCQSRDDDLGIHSLCVNDDFHWRFRMNIFENTNFFCGFLWDLKNVSF 172 PL IHC+S+ DDLGIH + ++H++F+ N++++T FFC F WD + SF Sbjct: 41 PLTIHCKSKQDDLGIHVVPFKQEYHFKFQPNLWKSTLFFCSFQWDSQFKSF 91 >gb|ABK28382.1| unknown [Arabidopsis thaliana] Length = 129 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +2 Query: 20 PLVIHCQSRDDDLGIHSLCVNDDFHWRFRMNIFENTNFFCGFLWDLKNVSF 172 PL IHC+S+ DDLGIH + ++H++F+ N++++T FFC F WD + SF Sbjct: 41 PLTIHCKSKQDDLGIHVVPFKQEYHFKFQPNLWKSTLFFCSFQWDSQFKSF 91 >gb|AAM64299.1| unknown [Arabidopsis thaliana] Length = 128 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +2 Query: 20 PLVIHCQSRDDDLGIHSLCVNDDFHWRFRMNIFENTNFFCGFLWDLKNVSF 172 PL IHC+S+ DDLGIH + ++H++F+ N++++T FFC F WD + SF Sbjct: 41 PLTIHCKSKQDDLGIHVVPFKQEYHFKFQPNLWKSTFFFCSFQWDSQFKSF 91 >emb|CAA60578.1| S3 self-incompatibility protein [Papaver rhoeas] gi|1107843|emb|CAA60579.1| S3 self-incompatibility protein [Papaver rhoeas] Length = 138 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/54 (44%), Positives = 29/54 (53%) Frame = +2 Query: 23 LVIHCQSRDDDLGIHSLCVNDDFHWRFRMNIFENTNFFCGFLWDLKNVSFGFGA 184 + IHCQS DDDLG H + + +W FR N T F+C WD K F F A Sbjct: 38 ITIHCQSEDDDLGTHVVSDGQEINWSFRENFMLTTRFYCYLQWDRKGKHFNFDA 91 >ref|XP_002892231.1| hypothetical protein ARALYDRAFT_887637 [Arabidopsis lyrata subsp. lyrata] gi|297338073|gb|EFH68490.1| hypothetical protein ARALYDRAFT_887637 [Arabidopsis lyrata subsp. lyrata] Length = 135 Score = 57.4 bits (137), Expect = 1e-06 Identities = 20/50 (40%), Positives = 34/50 (68%) Frame = +2 Query: 5 DSTATPLVIHCQSRDDDLGIHSLCVNDDFHWRFRMNIFENTNFFCGFLWD 154 + + PL +HC+S+ DDLG H + ++H++F+ N+++ T FFC F WD Sbjct: 43 EKSGPPLTVHCKSKQDDLGSHVVPFKQEYHFKFQTNLWKTTLFFCTFQWD 92