BLASTX nr result
ID: Cephaelis21_contig00040675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040675 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271991.2| PREDICTED: glucan endo-1,3-beta-glucosidase ... 99 4e-19 emb|CBI23036.3| unnamed protein product [Vitis vinifera] 99 4e-19 ref|XP_004145947.1| PREDICTED: glucan endo-1,3-beta-glucosidase-... 91 1e-16 ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, ... 91 1e-16 ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Ara... 89 5e-16 >ref|XP_002271991.2| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Vitis vinifera] Length = 874 Score = 99.0 bits (245), Expect = 4e-19 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -2 Query: 160 GKQWCLPKTGAKEDVLQNNIDYVCGLGLDCKPIQEGGACYLPNTVRAHAAFAM 2 GKQWCLP + A D LQ NIDYVCGLGLDCKPIQEGGAC++P+TVRAHAA+AM Sbjct: 379 GKQWCLPTSDAHSDALQKNIDYVCGLGLDCKPIQEGGACFIPDTVRAHAAYAM 431 >emb|CBI23036.3| unnamed protein product [Vitis vinifera] Length = 461 Score = 99.0 bits (245), Expect = 4e-19 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -2 Query: 160 GKQWCLPKTGAKEDVLQNNIDYVCGLGLDCKPIQEGGACYLPNTVRAHAAFAM 2 GKQWCLP + A D LQ NIDYVCGLGLDCKPIQEGGAC++P+TVRAHAA+AM Sbjct: 372 GKQWCLPTSDAHSDALQKNIDYVCGLGLDCKPIQEGGACFIPDTVRAHAAYAM 424 >ref|XP_004145947.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus] gi|449497400|ref|XP_004160391.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus] Length = 497 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 166 SRGKQWCLPKTGAKEDVLQNNIDYVCGLGLDCKPIQEGGACYLPNTVRAHAAFAM 2 S K+WCLPK+ A E+ LQ NIDYVCGLGLDC PI+E GAC+ PNTVRAHAA+ M Sbjct: 408 SESKRWCLPKSEASEEGLQRNIDYVCGLGLDCGPIKENGACFAPNTVRAHAAYVM 462 >ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] gi|223534417|gb|EEF36121.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] Length = 476 Score = 90.9 bits (224), Expect = 1e-16 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -2 Query: 160 GKQWCLPKTGAKEDVLQNNIDYVCGLGLD-CKPIQEGGACYLPNTVRAHAAFAM 2 GK+WCLPKTGA + LQ NIDYVCGLG + C+PIQ+ G C+LPNTVRAHAAFAM Sbjct: 385 GKRWCLPKTGADTEALQRNIDYVCGLGAEYCEPIQDNGKCFLPNTVRAHAAFAM 438 >ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana] gi|332005907|gb|AED93290.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana] Length = 458 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = -2 Query: 166 SRGKQWCLPKTGAKEDVLQNNIDYVCGLGLDCKPIQEGGACYLPNTVRAHAAFAM 2 S K+WC+ K GA+ LQ NIDYVCGLGLDC+PI EGG CYLPNTV+AH+ +AM Sbjct: 367 SSSKRWCVTKAGAETVALQRNIDYVCGLGLDCRPINEGGLCYLPNTVKAHSKYAM 421