BLASTX nr result
ID: Cephaelis21_contig00040539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040539 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|35... 63 2e-08 gb|AET22503.1| hypothetical protein [Solanum lycopersicum] 63 2e-08 >gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|356600308|gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium] Length = 886 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/77 (45%), Positives = 47/77 (61%) Frame = +3 Query: 3 FPKQVLKLIHLRYLALNVTFELPATISQLRNLQTFVIQGPWSSGEYSNCSKLLLEYWNMP 182 FP V+KL+HLRYLAL++ ELP +IS+L++LQT +I W + E L LE W MP Sbjct: 576 FPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY--WGTKE---MRILPLELWKMP 630 Query: 183 SLRHVFTSVASQLWNPP 233 LRH+ L+ P Sbjct: 631 ILRHIHVKGDVLLFGSP 647 >gb|AET22503.1| hypothetical protein [Solanum lycopersicum] Length = 888 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/77 (45%), Positives = 47/77 (61%) Frame = +3 Query: 3 FPKQVLKLIHLRYLALNVTFELPATISQLRNLQTFVIQGPWSSGEYSNCSKLLLEYWNMP 182 FP V+KL+HLRYLAL++ ELP +IS+L++LQT +I W + E L LE W MP Sbjct: 578 FPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY--WGTKE---MRILPLELWKMP 632 Query: 183 SLRHVFTSVASQLWNPP 233 LRH+ L+ P Sbjct: 633 ILRHIHVKGDVLLFGSP 649