BLASTX nr result
ID: Cephaelis21_contig00040464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040464 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB60054.1| 11S globulin precursor isoform 3 [Sesamum indicum] 56 3e-06 >gb|ABB60054.1| 11S globulin precursor isoform 3 [Sesamum indicum] Length = 491 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 134 AQLELPQQRVWQDLAEELQHRLRAKTPCNIKRLNAQRPSIKIPS 3 AQLEL QQR WQ L + QHRLRAKT C +++L A++PS ++ S Sbjct: 23 AQLELQQQRYWQSLQQHQQHRLRAKTECQVQQLTARQPSSRLQS 66