BLASTX nr result
ID: Cephaelis21_contig00040391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040391 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524440.1| RNA binding protein, putative [Ricinus commu... 74 2e-11 dbj|BAF00637.1| hypothetical protein [Arabidopsis thaliana] 55 5e-06 ref|NP_180130.1| tudor-like protein [Arabidopsis thaliana] gi|48... 55 5e-06 >ref|XP_002524440.1| RNA binding protein, putative [Ricinus communis] gi|223536228|gb|EEF37880.1| RNA binding protein, putative [Ricinus communis] Length = 383 Score = 73.6 bits (179), Expect = 2e-11 Identities = 44/108 (40%), Positives = 60/108 (55%), Gaps = 28/108 (25%) Frame = +2 Query: 14 MRFEKGSKVEVFNKKEV-SMSWRSGQILSGDDHTYNVQYYYY-----PGD---------- 145 MRF+KGSKVEVF+K +V S SWR +I+ G+ HTY V+Y + PGD Sbjct: 1 MRFKKGSKVEVFSKIDVPSGSWRCAEIICGNGHTYTVRYEAHAENWAPGDVVEVFDDFSW 60 Query: 146 ------------YYMVRLLGSSMESIVYKLNIRDRLLWLDDEWILMGK 253 Y++ R++GSS+E V K IR R W D +WI++GK Sbjct: 61 KMATISKVLGKKYFLARIVGSSLEFKVSKSGIRTRQSWQDGKWIVIGK 108 >dbj|BAF00637.1| hypothetical protein [Arabidopsis thaliana] Length = 164 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +2 Query: 14 MRFEKGSKVEVFNKKEVSMS-WRSGQILSGDDHTYNVQYYYY 136 MRF +GS+VEVF+ KE S WRS +I+SG+ HTYNV+YY + Sbjct: 1 MRFRRGSRVEVFSIKEASYGVWRSAEIISGNGHTYNVRYYSF 42 >ref|NP_180130.1| tudor-like protein [Arabidopsis thaliana] gi|4874300|gb|AAD31362.1| hypothetical protein [Arabidopsis thaliana] gi|330252627|gb|AEC07721.1| tudor-like protein [Arabidopsis thaliana] Length = 381 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +2 Query: 14 MRFEKGSKVEVFNKKEVSMS-WRSGQILSGDDHTYNVQYYYY 136 MRF +GS+VEVF+ KE S WRS +I+SG+ HTYNV+YY + Sbjct: 1 MRFRRGSRVEVFSIKEASYGVWRSAEIISGNGHTYNVRYYSF 42