BLASTX nr result
ID: Cephaelis21_contig00040149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040149 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283119.1| PREDICTED: probable inositol oxygenase [Viti... 75 4e-12 ref|XP_002311571.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 gb|AFK34985.1| unknown [Lotus japonicus] 74 9e-12 ref|XP_002515913.1| myoinositol oxygenase, putative [Ricinus com... 74 9e-12 ref|NP_001234593.1| myo-inositol oxygenase [Solanum lycopersicum... 74 1e-11 >ref|XP_002283119.1| PREDICTED: probable inositol oxygenase [Vitis vinifera] gi|297738724|emb|CBI27969.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 2 KYDLYSKSKVRVDVEKVKPYYLSLIEKYFPAKLRW 106 KYDLYSKSKVR+DVEKVKPYYLSLIEKYFPAKLRW Sbjct: 275 KYDLYSKSKVRIDVEKVKPYYLSLIEKYFPAKLRW 309 >ref|XP_002311571.1| predicted protein [Populus trichocarpa] gi|222851391|gb|EEE88938.1| predicted protein [Populus trichocarpa] Length = 283 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 2 KYDLYSKSKVRVDVEKVKPYYLSLIEKYFPAKLRW 106 KYDLYSKSKVR+DVEKVKPYYLSLIEKYFPAKLRW Sbjct: 249 KYDLYSKSKVRIDVEKVKPYYLSLIEKYFPAKLRW 283 >gb|AFK34985.1| unknown [Lotus japonicus] Length = 305 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 2 KYDLYSKSKVRVDVEKVKPYYLSLIEKYFPAKLRW 106 KYDLYSKSKVR+DVEKVKPYYLSLIEKYFPAKL+W Sbjct: 271 KYDLYSKSKVRIDVEKVKPYYLSLIEKYFPAKLKW 305 >ref|XP_002515913.1| myoinositol oxygenase, putative [Ricinus communis] gi|223544818|gb|EEF46333.1| myoinositol oxygenase, putative [Ricinus communis] Length = 229 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 2 KYDLYSKSKVRVDVEKVKPYYLSLIEKYFPAKLRW 106 KYDLYSKSKVR+DVEKVKPYYLSLIEKYFPAKL+W Sbjct: 195 KYDLYSKSKVRIDVEKVKPYYLSLIEKYFPAKLKW 229 >ref|NP_001234593.1| myo-inositol oxygenase [Solanum lycopersicum] gi|240248438|gb|ACS45396.1| myo-inositol oxygenase [Solanum lycopersicum] Length = 317 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 2 KYDLYSKSKVRVDVEKVKPYYLSLIEKYFPAKLRW 106 KYDLYSKSKVR+DVEKVKPYYLSLIEKYFP KLRW Sbjct: 283 KYDLYSKSKVRIDVEKVKPYYLSLIEKYFPTKLRW 317