BLASTX nr result
ID: Cephaelis21_contig00039391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00039391 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] 79 3e-13 emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 72 4e-11 emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 69 5e-10 gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebenn... 60 1e-07 emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana] gi|7... 59 3e-07 >emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] Length = 833 Score = 79.3 bits (194), Expect = 3e-13 Identities = 31/67 (46%), Positives = 50/67 (74%) Frame = +1 Query: 193 WNVRGAGSPRFPSVFREYVRLYKPSLVILVETRISGNRADKVIKKLGYNSSHRVEARGFA 372 WN RGAG +F ++ ++L++PS+V+L+E +ISG AD+VIK++G++ + ++ GFA Sbjct: 672 WNCRGAGELKFMRAIKDLIKLHEPSIVVLLEPKISGGDADQVIKEIGFSGQYHIDPEGFA 731 Query: 373 GGIWILW 393 GIWILW Sbjct: 732 HGIWILW 738 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/73 (42%), Positives = 49/73 (67%) Frame = +1 Query: 175 SFNAFVWNVRGAGSPRFPSVFREYVRLYKPSLVILVETRISGNRADKVIKKLGYNSSHRV 354 S VWNV+G G+ ++ RE +R+ P+++ LVET ISG++A ++ ++G++ RV Sbjct: 2 SIKIMVWNVQGVGTKL--TILRELMRINNPTVLALVETHISGDQAQRICDRIGFSGQTRV 59 Query: 355 EARGFAGGIWILW 393 EA GF GGIW+ W Sbjct: 60 EAEGFRGGIWLFW 72 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/70 (45%), Positives = 46/70 (65%) Frame = +1 Query: 184 AFVWNVRGAGSPRFPSVFREYVRLYKPSLVILVETRISGNRADKVIKKLGYNSSHRVEAR 363 A +WNVRGA S F + V+++KP L+IL+ET+ S RAD+ K+LGY + + A Sbjct: 3 AIIWNVRGANSKAFLWHALDLVKMHKPDLLILLETKCSSLRADQATKRLGYVNFRIIPAF 62 Query: 364 GFAGGIWILW 393 G GGIW++W Sbjct: 63 GKRGGIWLMW 72 >gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebennensis] Length = 464 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/71 (35%), Positives = 40/71 (56%) Frame = +1 Query: 181 NAFVWNVRGAGSPRFPSVFREYVRLYKPSLVILVETRISGNRADKVIKKLGYNSSHRVEA 360 N +WN RGA P F R ++ + ++ L ET G+R + + LG+ +S RV+ Sbjct: 2 NCLLWNCRGANKPNFRCSIRYILKKFNTDILALFETHAGGDREQRSCQGLGFENSFRVDV 61 Query: 361 RGFAGGIWILW 393 G +GG+W+LW Sbjct: 62 VGQSGGLWLLW 72 >emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana] gi|7268308|emb|CAB78602.1| hypothetical protein [Arabidopsis thaliana] Length = 655 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/71 (33%), Positives = 41/71 (57%) Frame = +1 Query: 181 NAFVWNVRGAGSPRFPSVFREYVRLYKPSLVILVETRISGNRADKVIKKLGYNSSHRVEA 360 N +WN RG P F R ++ + ++ L ET G+RA ++ ++LG+ + RV+A Sbjct: 509 NCLLWNCRGPNKPIFRRSIRYVLKKFDTDVLALFETHAGGDRAGRICQRLGFENQFRVDA 568 Query: 361 RGFAGGIWILW 393 G + G+W+LW Sbjct: 569 VGQSSGLWLLW 579