BLASTX nr result
ID: Cephaelis21_contig00038915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038915 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup2... 62 5e-08 emb|CBI28192.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_003625502.1| Nuclear pore complex protein Nup205 [Medicag... 55 5e-06 >ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup205-like [Vitis vinifera] Length = 1934 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 135 MVSPKQLLSIVEESLLGPNPPTPAQRIELIHAIR 236 MVSPKQLLSI+E SLLGP+PPTPAQ +ELIHAIR Sbjct: 1 MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIR 34 >emb|CBI28192.3| unnamed protein product [Vitis vinifera] Length = 1889 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 135 MVSPKQLLSIVEESLLGPNPPTPAQRIELIHAIR 236 MVSPKQLLSI+E SLLGP+PPTPAQ +ELIHAIR Sbjct: 1 MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIR 34 >ref|XP_003625502.1| Nuclear pore complex protein Nup205 [Medicago truncatula] gi|355500517|gb|AES81720.1| Nuclear pore complex protein Nup205 [Medicago truncatula] Length = 2047 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 135 MVSPKQLLSIVEESLLGPNPPTPAQRIELIHAIR 236 MVSPKQLLS +E +LLG +PPTP+QRIE++HAIR Sbjct: 1 MVSPKQLLSTLESALLGSSPPTPSQRIEVLHAIR 34