BLASTX nr result
ID: Cephaelis21_contig00037757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037757 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510663.1| pentatricopeptide repeat-containing protein,... 56 3e-06 >ref|XP_002510663.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551364|gb|EEF52850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/95 (38%), Positives = 49/95 (51%), Gaps = 9/95 (9%) Frame = +1 Query: 79 PLPFQFRFPSIRFSSPT----LRHHQQLFQPPLFSTSVATPANISTQTHQQLSLQNQSNK 246 P P RFPSI + P HH QL PPL +T+ + A S+ ++ LSL N Sbjct: 5 PPPPATRFPSITVTCPIPVRHYHHHSQL--PPLSATNTSATAIASSFSNLSLSLDNNQKD 62 Query: 247 EEQD-----DKRFDFSPLLQFFSTTCYTIPSSSSS 336 EQD +R+DF+PLL F S P++SSS Sbjct: 63 TEQDILALQSRRYDFTPLLNFLSNQIKASPNTSSS 97