BLASTX nr result
ID: Cephaelis21_contig00037562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037562 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 90 2e-16 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 89.7 bits (221), Expect = 2e-16 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 2/77 (2%) Frame = +3 Query: 54 AGRTCDGSQGSNMTT*VYVATILFYG--SGRLFRSSARFFGVVGEGFTFITHIQSYRHGP 227 AGRTCDGS SN+ + + ++ +G L FFGVVGEG TF+THI SYRHGP Sbjct: 88 AGRTCDGSPRSNIYDHLGLRCHDYFSMEAGGLLEVRPGFFGVVGEGLTFLTHIHSYRHGP 147 Query: 228 TDLFSIGASSNATRFYL 278 TDLFSIGASS+ATRFYL Sbjct: 148 TDLFSIGASSSATRFYL 164