BLASTX nr result
ID: Cephaelis21_contig00036435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036435 (712 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD83303.1| Fgenesh protein 124 [Beta vulgaris] 56 8e-06 >gb|ABD83303.1| Fgenesh protein 124 [Beta vulgaris] Length = 60 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/47 (55%), Positives = 39/47 (82%) Frame = +1 Query: 415 LQEEEMFEHITANEVAGYCVGALLLSATLSAPKIDYFIAASQRRYCF 555 L++EEM E+ITA+E+AG+ VG LL AT++APK+D FI+++Q+ CF Sbjct: 9 LEKEEM-ENITASEIAGFGVGTFLLCATIAAPKVDAFISSAQKSLCF 54