BLASTX nr result
ID: Cephaelis21_contig00036349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036349 (1289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173418.1| PREDICTED: serine/threonine-protein phosphat... 64 8e-08 ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphat... 64 8e-08 ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arab... 64 8e-08 ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arab... 64 8e-08 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein co... 64 8e-08 >ref|XP_004173418.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial [Cucumis sativus] Length = 385 Score = 63.9 bits (154), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 1289 GKRPLADVWALDTAAKSYKWQKLEREGEGPCSCM 1188 GKRPLADVWALDTAAK Y+W+KLE EGEGP CM Sbjct: 280 GKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCM 313 >ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis sativus] Length = 1002 Score = 63.9 bits (154), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 1289 GKRPLADVWALDTAAKSYKWQKLEREGEGPCSCM 1188 GKRPLADVWALDTAAK Y+W+KLE EGEGP CM Sbjct: 246 GKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCM 279 >ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana] gi|160359047|sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: Full=BSU1-like protein 3 gi|330252859|gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana] Length = 1006 Score = 63.9 bits (154), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 1289 GKRPLADVWALDTAAKSYKWQKLEREGEGPCSCM 1188 GKRPLADVWALDTAAK Y+W+KLE EGEGP CM Sbjct: 251 GKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCM 284 >ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana] gi|160359046|sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: Full=BSU1-like protein 2 gi|332190166|gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana] Length = 1018 Score = 63.9 bits (154), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 1289 GKRPLADVWALDTAAKSYKWQKLEREGEGPCSCM 1188 GKRPLADVWALDTAAK Y+W+KLE EGEGP CM Sbjct: 262 GKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCM 295 >tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr protein kinase family protein [Zea mays] Length = 998 Score = 63.9 bits (154), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 1289 GKRPLADVWALDTAAKSYKWQKLEREGEGPCSCM 1188 GKRPLADVWALDTAAK Y+W+KLE EGEGP CM Sbjct: 240 GKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCM 273