BLASTX nr result
ID: Cephaelis21_contig00036237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036237 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632535.1| PREDICTED: probable serine/threonine-protein... 85 5e-15 emb|CBI21542.3| unnamed protein product [Vitis vinifera] 85 5e-15 ref|XP_002310047.1| predicted protein [Populus trichocarpa] gi|2... 83 3e-14 ref|XP_002533885.1| Cell division protein kinase 7, putative [Ri... 81 1e-13 ref|XP_002524326.1| Cell division protein kinase, putative [Rici... 76 2e-12 >ref|XP_003632535.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like [Vitis vinifera] Length = 587 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/58 (63%), Positives = 49/58 (84%) Frame = +3 Query: 3 EDYWKKVKPPTTFRPTPNYKPSFQESFPNLPDSAFCLLTNLLSLDPVYRGTAASALES 176 EDYWKK++ PT+FRP YKPSFQ++F + P S+F LLT+LL+LDP +RG+AA+ALES Sbjct: 345 EDYWKKLRLPTSFRPPQQYKPSFQDAFRDFPSSSFALLTSLLALDPAFRGSAATALES 402 >emb|CBI21542.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/58 (63%), Positives = 49/58 (84%) Frame = +3 Query: 3 EDYWKKVKPPTTFRPTPNYKPSFQESFPNLPDSAFCLLTNLLSLDPVYRGTAASALES 176 EDYWKK++ PT+FRP YKPSFQ++F + P S+F LLT+LL+LDP +RG+AA+ALES Sbjct: 459 EDYWKKLRLPTSFRPPQQYKPSFQDAFRDFPSSSFALLTSLLALDPAFRGSAATALES 516 >ref|XP_002310047.1| predicted protein [Populus trichocarpa] gi|222852950|gb|EEE90497.1| predicted protein [Populus trichocarpa] Length = 331 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = +3 Query: 3 EDYWKKVKPPTTFRPTPNYKPSFQESFPNLPDSAFCLLTNLLSLDPVYRGTAASALES 176 EDYWK ++ PT+FRP +YKPSFQE+F + P+S+ LLT LL+L+P YRGTAASAL+S Sbjct: 258 EDYWKIMRLPTSFRPPQHYKPSFQEAFKDFPESSLVLLTTLLALNPAYRGTAASALQS 315 >ref|XP_002533885.1| Cell division protein kinase 7, putative [Ricinus communis] gi|223526162|gb|EEF28496.1| Cell division protein kinase 7, putative [Ricinus communis] Length = 572 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/58 (63%), Positives = 47/58 (81%) Frame = +3 Query: 3 EDYWKKVKPPTTFRPTPNYKPSFQESFPNLPDSAFCLLTNLLSLDPVYRGTAASALES 176 EDYWK ++ T+FRP +YKPSFQE+F + PDS+F LLT LL+L+P YRGTA SAL+S Sbjct: 330 EDYWKIMRLQTSFRPPQHYKPSFQEAFRDFPDSSFGLLTTLLALNPAYRGTATSALQS 387 >ref|XP_002524326.1| Cell division protein kinase, putative [Ricinus communis] gi|223536417|gb|EEF38066.1| Cell division protein kinase, putative [Ricinus communis] Length = 483 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/59 (57%), Positives = 46/59 (77%) Frame = +3 Query: 3 EDYWKKVKPPTTFRPTPNYKPSFQESFPNLPDSAFCLLTNLLSLDPVYRGTAASALESE 179 EDYWKK++ TTFRP +YKPS E+F P+S+ LLT LL+LDP YRG+A+SAL+++ Sbjct: 309 EDYWKKLRLSTTFRPPKSYKPSLFEAFGEFPESSLGLLTTLLALDPAYRGSASSALQND 367